KEGG   Rattus norvegicus (rat): 25075Help
Entry
25075             CDS       T01003                                 

Gene name
Htr1b
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04726  Serotonergic synapse
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25075 (Htr1b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25075 (Htr1b)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    25075 (Htr1b)
  09157 Sensory system
   04742 Taste transduction
    25075 (Htr1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25075 (Htr1b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    25075 (Htr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 25075
NCBI-ProteinID: NP_071561
RGD: 2846
Ensembl: ENSRNOG00000013042
UniProt: P28564
Position
8q31
AA seq 386 aa AA seqDB search
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcagggtattcagtgcgctccgccgcctcccgccacctcccagacaggggta
cctctcgccaacctctcccacaactgcagcgccgacgactacatttaccaggactccatc
gccctgccctggaaagtcctgctggttgctttgttagcgctcatcaccttggccaccacg
ctctccaacgcctttgtaatcgctacggtgtatcggacccggaagctgcacaccccggct
aactacctgatcgcctcgctggcagtcactgacctgctcgtgtccatcctggtgatgccc
atcagcaccatgtacacggtcactggacgctggacactaggccaggtggtctgcgacttc
tggctgtcgtcggatatcacctgttgcactgcttccatcatgcatctctgtgtcatcgcc
ctggaccgctactgggccatcactgatgcggtggactattctgctaaaagaactcccaaa
agggcggccatcatgatcgtgctggtgtgggtcttctccatctcgatttcgctgccaccc
ttcttctggcgtcaagccaaagcggaggaggaggtgctggactgctttgtgaacaccgac
cacgtcctctacacggtctactccacggtgggggctttctatttacccaccctgctcctc
atcgccctctatggccgtatctatgtggaagcccgctctcggattttgaaacagacaccc
aacaagaccggcaagcgcttgacccgagcccagttgataacagactctccaggatccacg
tcctcggtcacctccattaactcccgggttccggaggtgcccagtgagtccgggtctcct
gtgtacgtgaaccaagtcaaagtgcgagtctcagacgccctgctggaaaagaagaaactc
atggccgctagggagcgcaaagccaccaagaccctagggatcattttaggagcatttatt
gtgtgctggctccccttcttcatcatctccctggtgatgcctatctgcaaggatgcctgc
tggtttcacatggccatttttgactttttcaattggctaggctatcttaactctctcatc
aaccccatcatctacaccatgtccaatgaggacttcaaacaagcattccataaactgata
cgctttaagtgcacaggttga

DBGET integrated database retrieval system