KEGG   Rattus norvegicus (rat): 25080Help
Entry
25080             CDS       T01003                                 

Gene name
Apoa4, Apo-AIV, ApoA-IV, apoAIV
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04975  Fat digestion and absorption
rno04977  Vitamin digestion and absorption
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    25080 (Apoa4)
   04979 Cholesterol metabolism
    25080 (Apoa4)
   04977 Vitamin digestion and absorption
    25080 (Apoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH Baculo_PEP_C Gp58 ApoLp-III DUF4795 DUF883 SF-assemblin Apo-CIII OmpH AAA_32 DUF445 DUF4455 Phasin Prominin CorA BshC Imm49 MAAL_C Exonuc_VII_L DUF1664 FAM184 DUF4407 DUF1640 DUF72 ApoA-II ANAPC4 ZYG-11_interact DUF1451 DUF948
Motif
Other DBs
NCBI-GeneID: 25080
NCBI-ProteinID: NP_036869
RGD: 2132
Ensembl: ENSRNOG00000055909
UniProt: P02651
Position
8q22
AA seq 391 aa AA seqDB search
MFLKAVVLTVALVAITGTQAEVTSDQVANVMWDYFTQLSNNAKEAVEQLQKTDVTQQLNT
LFQDKLGNINTYADDLQNKLVPFAVQLSGHLTKETERVREEIQKELEDLRANMMPHANKV
SQMFGDNVQKLQEHLRPYATDLQAQINAQTQDMKRQLTPYIQRMQTTIQDNVENLQSSMV
PFANELKEKFNQNMEGLKGQLTPRANELKATIDQNLEDLRSRLAPLAEGVQEKLNHQMEG
LAFQMKKNAEELHTKVSTNIDQLQKNLAPLVEDVQSKLKGNTEGLQKSLEDLNKQLDQQV
EVFRRAVEPLGDKFNMALVQQMEKFRQQLGSDSGDVESHLSFLEKNLREKVSSFMSTLQK
KGSPDQPLALPLPEQVQEQVQEQVQPKPLES
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtgctgaccgtggccctggtggccatcaccgggacccaggct
gaggtcacttccgaccaggtggccaatgtgatgtgggactacttcacccagctaagcaac
aatgccaaggaggctgtggaacaactgcagaagacagatgtcactcaacagctcaatacc
ctcttccaggacaaacttgggaacattaacacctatgccgatgacctgcagaacaagctg
gtgcccttcgccgttcaactgagtggacatctaaccaaggaaacagagagggtgagggaa
gagatccagaaggagctcgaggacctacgggccaacatgatgccccatgccaacaaagtg
agccagatgttcggggacaacgtgcagaagttgcaggaacacctgaggccctatgccacg
gacctgcaagctcagatcaacgcacagacccaggatatgaaacgccagctgaccccctac
atccagcgcatgcagaccacaatacaagacaatgtggaaaacctgcagtcctccatggtg
ccctttgccaacgagctaaaggaaaagtttaaccagaatatggaagggctcaaggggcaa
ctaaccccccgtgccaacgagctgaaggccacgatcgaccagaacctggaagacctgcgc
agcagactggcccctctcgcggagggtgtgcaggaaaaactcaaccatcagatggaaggc
ttggccttccagatgaagaagaacgctgaggagctccataccaaagtctccacaaatatc
gaccagctgcagaagaatctggccccgctggtggaagatgtgcaaagcaagctgaaaggc
aacacggaaggactgcagaagtctctggaagacctgaacaagcagctggaccagcaggtg
gaggtgttccggcgtgctgtggagcccctgggggataagttcaacatggctctggtgcag
cagatggagaagttcaggcagcagctgggctccgattcgggggacgtggaaagccacttg
agcttcctggagaagaacctgagggaaaaggtcagctcctttatgagcaccctgcaaaaa
aaggggagcccagaccagcccctagccctccccctcccggagcaggttcaggaacaggtc
caggagcaggtgcagcccaaacctctggagagctga

DBGET integrated database retrieval system