KEGG   Rattus norvegicus (rat): 25081Help
Entry
25081             CDS       T01003                                 

Gene name
Apoa1, apoA-I
Definition
(RefSeq) apolipoprotein A1
  KO
K08757  apolipoprotein A-I
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04975  Fat digestion and absorption
rno04977  Vitamin digestion and absorption
rno04979  Cholesterol metabolism
rno05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    25081 (Apoa1)
  09154 Digestive system
   04975 Fat digestion and absorption
    25081 (Apoa1)
   04979 Cholesterol metabolism
    25081 (Apoa1)
   04977 Vitamin digestion and absorption
    25081 (Apoa1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    25081 (Apoa1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25081 (Apoa1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   25081 (Apoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH DUF883 ApoLp-III Exonuc_VII_L HIP1_clath_bdg KMP11 Gp58 OmpH ARGLU DUF1664 WXG100 Hat1_N LPAM_1 Prefoldin_2 Fib_alpha DUF1451
Motif
Other DBs
NCBI-GeneID: 25081
NCBI-ProteinID: NP_036870
RGD: 2130
Ensembl: ENSRNOG00000045679
UniProt: P04639
Position
8q22
AA seq 259 aa AA seqDB search
MKAAVLAVALVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESST
LGKQLNLNLLDNWDTLGSTVGRLQEQLGPVTQEFWANLEKETDWLRNEMNKDLENVKQKM
QPHLDEFQEKWNEEVEAYRQKLEPLGTELHKNAKEMQRHLKVVAEEFRDRMRVNADALRA
KFGLYSDQMRENLAQRLTEIKNHPTLIEYHTKASDHLKTLGEKAKPALDDLGQGLMPVLE
AWKAKIMSMIDEAKKKLNA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtgttggctgtggccctggtcttcctgacaggttgccaagcttgggag
ttctggcagcaagatgagccccagtcccaatgggacagggtgaaggatttcgccactgtg
tatgtggatgcagtcaaggacagcggcagagactatgtgtcccagtttgaatcctccact
ttgggcaaacagctgaacctgaatctcctggacaactgggacactctgggttcaactgtt
ggtcgcctacaggaacagctaggcccagtgactcaggagttctgggctaacctggagaaa
gaaacagattggctgagaaacgagatgaacaaggacctggagaatgtgaaacagaagatg
cagccccacctggatgaattccaggagaagtggaacgaggaggtcgaggcctaccgccag
aagctggagcctctgggcaccgagcttcacaaaaacgcgaaggagatgcaaaggcatcta
aaggttgtggccgaggagtttcgagaccgcatgcgtgtgaatgcagacgcgctgcgcgca
aagtttgggctctacagcgatcagatgcgcgagaacctggcccagcgcctgaccgagatc
aagaaccaccctaccctgatcgagtatcataccaaggccagcgaccacctgaagacactt
ggtgagaaagccaaacccgcgctggatgacctgggccagggcctgatgccggtgctggaa
gcctggaaggccaaaatcatgagtatgatcgatgaggccaaaaagaagctgaacgcttag

DBGET integrated database retrieval system