KEGG   Rattus norvegicus (rat): 25081
Entry
25081             CDS       T01003                                 

Gene name
Apoa1
Definition
(RefSeq) apolipoprotein A-I preproprotein
  KO
K08757  apolipoprotein A-I
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04975  Fat digestion and absorption
rno04977  Vitamin digestion and absorption
rno04979  Cholesterol metabolism
rno05143  African trypanosomiasis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    25081 (Apoa1)
  09154 Digestive system
   04975 Fat digestion and absorption
    25081 (Apoa1)
   04979 Cholesterol metabolism
    25081 (Apoa1)
   04977 Vitamin digestion and absorption
    25081 (Apoa1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    25081 (Apoa1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25081 (Apoa1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25081 (Apoa1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   25081 (Apoa1)
SSDB
Motif
Pfam: Apolipoprotein YtxH ApoLp-III RRF Exonuc_VII_L HIP1_clath_bdg KMP11 ORC3_ins OmpH Gp58 DUF6074 BshC EspB Fib_alpha DUF1640 ARGLU WXG100 Hat1_N fvmX5 Mitofilin DUF1664 Prefoldin_2
Other DBs
NCBI-GeneID: 25081
NCBI-ProteinID: NP_036870
RGD: 2130
Ensembl: ENSRNOG00000045679
UniProt: P04639
Position
8
AA seq 259 aa
MKAAVLAVALVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESST
LGKQLNLNLLDNWDTLGSTVGRLQEQLGPVTQEFWANLEKETDWLRNEMNKDLENVKQKM
QPHLDEFQEKWNEEVEAYRQKLEPLGTELHKNAKEMQRHLKVVAEEFRDRMRVNADALRA
KFGLYSDQMRENLAQRLTEIKNHPTLIEYHTKASDHLKTLGEKAKPALDDLGQGLMPVLE
AWKAKIMSMIDEAKKKLNA
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaagctgcagtgttggctgtggccctggtcttcctgacaggttgccaagcttgggag
ttctggcagcaagatgagccccagtcccaatgggacagggtgaaggatttcgccactgtg
tatgtggatgcagtcaaggacagcggcagagactatgtgtcccagtttgaatcctccact
ttgggcaaacagctgaacctgaatctcctggacaactgggacactctgggttcaactgtt
ggtcgcctacaggaacagctaggcccagtgactcaggagttctgggctaacctggagaaa
gaaacagattggctgagaaacgagatgaacaaggacctggagaatgtgaaacagaagatg
cagccccacctggatgaattccaggagaagtggaacgaggaggtcgaggcctaccgccag
aagctggagcctctgggcaccgagcttcacaaaaacgcgaaggagatgcaaaggcatcta
aaggttgtggccgaggagtttcgagaccgcatgcgtgtgaatgcagacgcgctgcgcgca
aagtttgggctctacagcgatcagatgcgcgagaacctggcccagcgcctgaccgagatc
aagaaccaccctaccctgatcgagtatcataccaaggccagcgaccacctgaagacactt
ggtgagaaagccaaacccgcgctggatgacctgggccagggcctgatgccggtgctggaa
gcctggaaggccaaaatcatgagtatgatcgatgaggccaaaaagaagctgaacgcttag

DBGET integrated database retrieval system