KEGG   Rattus norvegicus (rat): 25084Help
Entry
25084             CDS       T01003                                 

Gene name
Il4r, Il4ra
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  Jak-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05200  Pathways in cancer
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    25084 (Il4r)
   04151 PI3K-Akt signaling pathway
    25084 (Il4r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25084 (Il4r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25084 (Il4r)
   04658 Th1 and Th2 cell differentiation
    25084 (Il4r)
   04659 Th17 cell differentiation
    25084 (Il4r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25084 (Il4r)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    25084 (Il4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25084 (Il4r)
   04090 CD molecules [BR:rno04090]
    25084 (Il4r)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   25084 (Il4r)
CD molecules [BR:rno04090]
 Proteins
  25084 (Il4r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4Ra_N fn3
Motif
Other DBs
NCBI-GeneID: 25084
NCBI-ProteinID: NP_596871
RGD: 2899
Ensembl: ENSRNOG00000015441
UniProt: Q63257
Position
1q36
AA seq 801 aa AA seqDB search
MGWLCTKFLSSVSCLILLWVTGSGGIKVLGDPTCFSDYIRTSTCEWQLDSTVDCSSQLLL
DYRLLFEFSENLTCTPKNSADTVCVCQMAIEEPIQADTYWLELWSERGQLWQGSFKPSDN
VKPPAPDNLTLHTNVSNALLLMWSNPYPSNNFLHKGLICMVNISREDNPAEFKVYNVTYT
EPKLSFPVNTLTSGVRYRARVRVLSQSFPGIWSEWSPSITWYNHFQLPLLQRLPLGVSIS
CICILLFCLTCYFSIIKIKKIWWDQIPTPARSPLAAIIIQDTKVSLWEKQTRSQESTKSR
HWKTCLTKLLPCLLEHRVKKERESPKAAKTKPLQSPEKAGWYPAEVSRTVLWPENVHVSV
VRCMELFEAPVQNVEEEEDEMVKGDLSMSPENSGGGFQESQADIMARLTENLFSDLLGAE
NGGVGQSSMAESSSLLPSESGQASTSWACFPTGPSETTCQVTGQQPPHPDPERATGTACT
QVPLVISDNPAYRSFSDFSSPAPNPGELASEQKQAGHLEEGDLLSPVDPHSSGPPMQQAE
SWEQILHMSVLQHGTAGSTPAPTSGYQEFVQAVKQGASQDAGVPGVGPSGDTGYKAFSSL
LSSSGVCTDTAAAGTDSGCGGYKPFQNPVPNQSPNSMPLFTFGLDMELPPSPLNSAPPNS
TPECLGLELGLKGGTWLKAPPPSEQVPKPFGDDLGLGIVYSSLTCHLCGHLKQHHSQEED
GQIHVVASPGCGCCYDEKSPSLGNLSGTLESCPGEMSQEANLTLAPRTPSNLSGVGKGPG
HSPVPSQTTEVPVGTLGVTVS
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggggtggctttgcaccaagttcctgtcctccgtgagctgtctgattttgctatgggtg
actggctctgggggcatcaaggtcctgggtgaccccacctgcttctctgactacatccgc
acttctacgtgtgagtggcagctggatagcactgtggactgcagttctcagctcctcctg
gactacaggctgctctttgagttctctgaaaacctcacatgcacccccaagaacagtgcc
gacaccgtgtgtgtgtgccaaatggccatagaggagccgatccaggcagacacatactgg
ctggaactgtggtctgagcggggacagctgtggcaaggctccttcaagcctagtgacaat
gtgaagcccccagctccagacaacctcacactccacaccaatgtctccaatgcgctgctg
ctgatgtggagcaacccatacccatcgaacaacttcctgcacaaaggcctcatctgcatg
gtcaacatctccagagaggacaacccggcggaattcaaagtctataatgtgacctacacg
gaacccaagctgagcttcccagtcaacaccctaacatcaggggtgcgctatagggcacgt
gtgagggtcttgtcccagagcttccctggcatctggagtgagtggagtcccagcatcacg
tggtacaaccacttccagctgcccctgctgcagcgcctcccgctgggtgtcagcatctcc
tgcatctgcatcctattgttttgcctgacctgttacttcagcattatcaagattaagaag
atatggtgggaccagattcccactccagcacgcagtcccttagcagccatcatcattcag
gacacgaaggtgtccctctgggagaagcagacccgaagccaggagtcaaccaagagccgg
cactggaagacttgtctaaccaagctgctgccctgcttgctggagcatagagtgaagaaa
gagagagaatccccgaaggctgccaaaaccaagcctctccagagtcctgaaaaagcaggc
tggtatcctgcggaggtcagcaggaccgtcctctggccagagaacgttcatgtcagtgtg
gtgcgctgtatggagctgtttgaggccccagtacagaatgtggaggaggaagaggatgag
atggtcaaaggggacctgagcatgtcacctgagaacagcggagggggcttccaggagagt
caggcagacatcatggcccggctcactgagaacctgttttcagacttgctgggggctgag
aatggaggcgttggccagtcgagcatggcagagtcatcctcccttctgccttcagaaagt
gggcaagcttctacgtcctgggcctgcttccccacggggcccagtgagaccacatgccag
gtcacagggcagcagcctccacacccagaccctgagagagcaactggcacagcctgcaca
caggtcccccttgtcatttcagacaatcctgcctaccggagttttagtgacttctccagc
cccgccccaaatcctggagagctggcttcagaacagaagcaggctggacatctggaagaa
ggggatcttctgagcccggttgacccccattcttcagggccaccaatgcagcaagcggag
agctgggagcagatccttcacatgagtgtcctgcagcacgggacagctggctccacccca
gcccctaccagtggctaccaagagtttgtgcaggcagtgaagcagggtgcgtcccaggac
gctggggtgcctggtgtcgggccttctggagacactggttacaaggctttctcgagcctg
ctcagcagcagtggcgtctgcacggacacagcagcagcagggactgacagtggatgtgga
gggtacaagcccttccagaaccctgttcctaaccagtcccccaactccatgcccttattc
accttcggactggacatggagctgccacccagtcccctgaactcagccccacccaatagc
accccagaatgccttggtctagagctggggctcaaaggaggcacctggctgaaggcccct
cctccttcagagcaggtgcccaagccctttggggatgacctgggccttggcattgtgtac
tcgtccctcacctgccatctgtgtggccacctgaagcaacaccacagccaggaggaagat
ggtcagatccatgtcgttgctagccctggctgcggctgttgctatgatgaaaaatcacca
tccttggggaatctctcggggaccttggagagctgtcctggggaaatgtcacaggaagcc
aacctcaccttagcacccaggacaccctccaatttgtcaggggtgggcaagggccctggc
cactctcctgttcccagccagactactgaggtacctgtgggcactctgggcgtcactgtg
tcttag

DBGET integrated database retrieval system