KEGG   Rattus norvegicus (rat): 25085
Entry
25085             CDS       T01003                                 

Gene name
Th
Definition
(RefSeq) tyrosine 3-monooxygenase
  KO
K00501  tyrosine 3-monooxygenase [EC:1.14.16.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00350  Tyrosine metabolism
rno00790  Folate biosynthesis
rno01100  Metabolic pathways
rno04728  Dopaminergic synapse
rno04917  Prolactin signaling pathway
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Module
rno_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    25085 (Th)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    25085 (Th)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    25085 (Th)
  09156 Nervous system
   04728 Dopaminergic synapse
    25085 (Th)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25085 (Th)
  09165 Substance dependence
   05030 Cocaine addiction
    25085 (Th)
   05031 Amphetamine addiction
    25085 (Th)
   05034 Alcoholism
    25085 (Th)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.2  tyrosine 3-monooxygenase
     25085 (Th)
SSDB
Motif
Pfam: Biopterin_H TOH_N
Other DBs
NCBI-GeneID: 25085
NCBI-ProteinID: NP_036872
RGD: 3853
Ensembl: ENSRNOG00000020410
UniProt: P04177
Structure
PDB: 
2TOH 1TOH 2MDA

Position
1
AA seq 498 aa
MPTPSAPSPQPKGFRRAVSEQDAKQAEAVTSPRFIGRRQSLIEDARKEREAAAAAAAAAV
ASSEPGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQ
RPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSAREDKVPWFPRKVSELDKCHHL
VTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYKHGEPIPHVEYTAEEIATWKEVYVTL
KGLYATHACREHLEGFQLLERYCGYREDSIPQLEDVSRFLKERTGFQLRPVAGLLSARDF
LASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGAS
DEEIEKLSTVYWFTVEFGLCKQNGELKAYGAGLLSSYGELLHSLSEEPEVRAFDPDTAAV
QPYQDQTYQPVYFVSESFNDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIQRSL
EGVQDELHTLAHALSAIS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgcccacccccagcgccccctcgccacagcccaagggcttcagaagggccgtctcagag
caggatgccaagcaggccgaggctgtcacgtccccaaggttcatcggacggcgacagagt
ctcatcgaggatgcccgcaaggagcgggaggcggcggcagctgcagcagcagcagcggta
gcctcctcggaacctgggaacccactggaggctgtggtatttgaggagagggatgggaat
gctgttctcaacctgctcttctccctgaggggtacaaaaccctcctccttgtctcgggct
gtaaaagtatttgagacatttgaagccaaaattcaccacttagagacccggcctgcccag
aggccactggcaggaagcccccacctggagtattttgtgcgcttcgaggtgcccagtgga
gacctggctgccctcctcagctctgtgcgtcgggtgtctgacgacgtgcgcagtgctaga
gaggacaaggtcccctggttcccaagaaaagtgtcggaattggacaagtgtcaccacctg
gtcaccaagtttgaccctgatctggacctggaccacccgggcttctctgaccaggtgtat
cgccagcgtcggaagctgattgcagagattgccttccagtacaagcacggtgaaccaatt
ccccatgtggaatacacagcggaagagattgctacctggaaggaggtatatgtcacgctg
aagggcctctatgctacccatgcctgccgggagcacctggagggtttccagcttctggaa
cggtactgtggctaccgagaggacagcatcccacagctggaggacgtgtcccgcttcttg
aaggagcggactggcttccagctgcgacccgtggccggtctactgtccgcccgtgatttt
ctggccagtctggccttccgcgtgtttcaatgcacccagtatatccgccatgcctcctca
cctatgcattcacctgagccggactgctgccatgagctgttgggacatgtacccatgttg
gctgaccgcacatttgcccagttctcccaggacattggacttgcatctctgggggcctca
gatgaagaaattgaaaaactctccacggtgtactggttcactgtggaattcgggctatgt
aaacagaatggggagctgaaggcttatggtgcagggctgctgtcttcctacggagagctc
ctgcactccctgtcagaggagcctgaggtccgagcctttgacccagacacagcagctgtg
cagccctaccaagatcaaacctaccagcctgtgtactttgtgtccgagagcttcaatgac
gccaaggacaagctcaggaactatgcctctcgtatccagcgcccattctctgtgaagttt
gacccgtacacactggccattgacgtactggacagccctcacaccatccagcgctccttg
gagggggtccaggatgagctgcacaccctggcccacgcactgagtgccattagctaa

DBGET integrated database retrieval system