KEGG   Rattus norvegicus (rat): 25086
Entry
25086             CDS       T01003                                 

Gene name
Cyp2e1
Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  cytochrome P450 family 2 subfamily E1 [EC:1.14.14.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno04932  Non-alcoholic fatty liver disease
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    25086 (Cyp2e1)
   00590 Arachidonic acid metabolism
    25086 (Cyp2e1)
   00591 Linoleic acid metabolism
    25086 (Cyp2e1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25086 (Cyp2e1)
   00982 Drug metabolism - cytochrome P450
    25086 (Cyp2e1)
   00983 Drug metabolism - other enzymes
    25086 (Cyp2e1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    25086 (Cyp2e1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25086 (Cyp2e1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    25086 (Cyp2e1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     25086 (Cyp2e1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   25086 (Cyp2e1)
SSDB
Motif
Pfam: p450 DUF6361
Other DBs
NCBI-GeneID: 25086
NCBI-ProteinID: NP_113731
RGD: 2475
Ensembl: ENSRNOG00000012458
UniProt: P05182
Position
1
AA seq 493 aa
MAVLGITIALLVWVATLLVISIWKQIYNSWNLPPGPFPLPILGNIFQLDLKDIPKSFTKL
AKRFGPVFTLHLGSRRIVVLHGYKAVKEVLLNHKNEFSGRGDIPVFQEYKNKGIIFNNGP
TWKDVRRFSLSILRDWGMGKQGNEARIQREAQFLVEELKKTKGQPFDPTFLIGCAPCNVI
ADILFNKRFDYNDKKCLRLMSLFNENFYLLSTPWIQLYNNFADYLRYLPGSHRKIMKNVS
EIKQYTLEKAKEHLQSLDINCARDVTDCLLIEMEKEKHSQEPMYTMENVSVTLADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRVPAVRDRLDMPYMDAVVHEIQRF
INLVPSNLPHEATRDTVFQGYVIPKGTVVIPTLDSLLYDSHEFPDPEKFKPEHFLNENGK
FKYSDYFKAFSAGKRVCVGEGLARMELFLLLSAILQHFNLKSLVDPKDIDLSPVTVGFGS
IPPQFKLCVIPRS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcggttcttggcatcaccattgccttgctggtgtgggtggccaccctcctcgtcata
tccatctggaagcagatctataacagttggaacctgcccccaggacctttccctcttccc
atccttgggaacatttttcagctggatttgaaggatatccccaagtctttcaccaagttg
gcaaagcgcttcgggccagtgttcacactgcaccttggctcaaggcgcatcgtggtcctg
catggctacaaggctgtcaaggaggtgctactgaaccacaagaatgagttttctggacgg
ggggacattcctgtgttccaggagtacaagaacaaggggattattttcaataatgggccc
acatggaaggatgtgcggaggttttccctaagcattctccgagactggggaatggggaaa
cagggtaatgaggcccgcatccaaagggaggcgcaattcctggtggaggagctcaaaaag
accaaaggccagccttttgaccccacatttctgattggctgcgcaccctgcaatgtcatt
gcggatatcctcttcaacaaacgtttcgactacaatgacaagaagtgtctgaggctcatg
agtttgttcaatgaaaacttctacctgctgagcaccccctggatccagctttacaataac
tttgcggattatctacgatacctacctggaagccatagaaaaatcatgaaaaatgtgtct
gaaataaaacagtacacacttgaaaaagccaaggaacaccttcagtcactggacatcaac
tgcgcccgggatgtgactgactgtctcctcatagagatggagaaggaaaaacacagccaa
gaacccatgtacacaatggaaaatgtttctgtgactttggccgacctgttctttgcagga
actgagaccaccagcacaactctgagatatgggctcctgatcctcatgaaatacccagaa
attgaagagaaacttcatgaagaaattgacagggttattgggccaagccgcgtccctgct
gtcagagacagactggatatgccctacatggatgctgtggtgcatgagatccagagattc
atcaatcttgtcccttccaacctaccccatgaagcaaccagagatactgtgttccaagga
tatgtcatccccaagggtacagttgtgattccaactctggactccctcttatatgacagc
catgagtttccagatccagagaagtttaaacctgagcatttcctgaatgaaaatgggaag
ttcaagtacagtgactatttcaaggcattttctgcaggaaagcgtgtgtgtgttggagaa
ggcctggcccgcatggaattgtttctgctcctgtctgctattctgcagcattttaacctg
aagtctctggttgaccctaaggatatcgacctcagtcctgtcacagttggctttggcagt
atcccaccccaatttaaactctgtgtcattccccgttcatga

DBGET integrated database retrieval system