KEGG   Rattus norvegicus (rat): 25094
Entry
25094             CDS       T01003                                 

Gene name
Mitf
Definition
(RefSeq) melanogenesis associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04380  Osteoclast differentiation
rno04916  Melanogenesis
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05218  Melanoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    25094 (Mitf)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    25094 (Mitf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25094 (Mitf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25094 (Mitf)
   05202 Transcriptional misregulation in cancer
    25094 (Mitf)
  09162 Cancer: specific types
   05218 Melanoma
    25094 (Mitf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25094 (Mitf)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    25094 (Mitf)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH DUF726
Other DBs
NCBI-GeneID: 25094
NCBI-ProteinID: NP_001178018
RGD: 3092
Ensembl: ENSRNOG00000008658
UniProt: O88368
Position
4q34
AA seq 526 aa
MQSESGIVADFEVGEEFHEEPKTYYELKSQPLKSSSSAEHSGASKPPLSSSTMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVAVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRHQVKQYLSTTLANKHAGQVLSPPCPNQPGDHAMPPVPGSSAPNS
PMAMLTLNSNCEKEAFYKFEEQSRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYSNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE
SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY
IRKLQREQQRAKDLENRQKKLEHANRHLLLRVQELEMQARAHGLSLIPSTGLCSPDLVNR
IIKQEPVLENCSQELVQHQADLTCTTTLDLTDGTISFTNNLGTMPESSPAYSIPRKMASN
LEDILMDDALSPVGVTDPLLSSVSPGASKTSSRRSSMSAEETEHAC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcagtctgaatcgggaatcgtggcggatttcgaagtcggggaggagtttcacgaagaa
cccaaaacctattacgaactcaaaagtcaacctctgaagagcagcagttctgcagagcat
tctggggcctccaagcctccgttaagctcctccactatgacatcacgcatcttgctacgc
cagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcagaagctg
caggcagcccagttcatgcaacagagagtggccgtgagtcagacaccagccataaacgtc
agcgtgcccaccacccttccctctgccacccaggtgccgatggaagtcctcaaggtgcag
acccacctggaaaaccccaccaagtaccacatacagcaagcccagaggcaccaggtaaag
cagtacctttctaccactttagcaaacaaacatgccggccaagtcctgagcccgccatgt
ccaaaccagcctggcgaccatgccatgcctccagtgccggggagcagcgcacccaacagc
cccatggctatgctcactcttaactccaactgtgaaaaagaggcgttttataagtttgag
gagcagagcagggcagagagtgagtgcccaggtatgaacacgcactctcgagcttcgtgc
atgcagatggatgatgtgattgatgacatcatcagcctggaatcaagttataatgaagaa
attttgggcttgatggatccggccttgcaaatggcaaatacgttacctgtctctggaaac
ttgatcgacctatacagcaaccagggcctgccacccccaggccttaccatcagcaactct
tgtccagccaaccttcccaacataaaaagagagctcacagcgtgtattttccccacagag
tctgaagcaagagcattggctaaagagaggcagaaaaaggacaatcacaacttgattgaa
cggagaagaagatttaacataaatgaccgcattaaggaactaggtactttgattcccaag
tcaaacgatccggacatgcgttggaacaaggggaccatcctcaaggcctccgtggactac
atccgaaagttgcaacgggaacagcagcgagctaaggaccttgaaaaccggcagaagaag
ctggagcatgctaaccgccatctgctgctcagagtgcaggagctcgagatgcaggctaga
gcacatgggctttctcttatcccatccacgggtctctgctcgcctgatttggtgaatcgg
atcatcaagcaagaaccagttcttgagaactgcagccaggaacttgtacagcaccaggca
gacctgacatgcacaacgactctggatctcacggacggtaccatctcctttaccaacaac
ctcggcacaatgcctgagagcagcccggcctacagcatccccaggaagatggcctccaac
ttggaagacatcctgatggacgatgccctctcacctgtcggcgtcaccgacccactgctg
tcatcagtgtccccaggagcttcgaaaacaagcagccggaggagcagtatgagcgcagaa
gaaacggagcatgcgtgttag

DBGET integrated database retrieval system