KEGG   Rattus norvegicus (rat): 25095
Entry
25095             CDS       T01003                                 

Gene name
Ampd3
Definition
(RefSeq) adenosine monophosphate deaminase 3
  KO
K01490  AMP deaminase [EC:3.5.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    25095 (Ampd3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     25095 (Ampd3)
SSDB
Motif
Pfam: A_deaminase
Other DBs
NCBI-GeneID: 25095
NCBI-ProteinID: NP_113732
RGD: 2111
Ensembl: ENSRNOG00000018262
UniProt: O09178
Position
1q33
AA seq 801 aa
MRAPVCVGRGGKVIQGTSSTPGEHQRLLVGLATKTEMPRQFPKLNMSDLDEHVRLLAEKV
FAKVLREEDSKDVMSLFTVPKDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQ
SMSLQMPTQDWKGPPSVSPAMSPTTPLVLGAASKPGLAPYDMPEYQRATISGDYCAGITM
EDYEQAAKSLAKALMIREKYARLAYHRFPRTTAQYLAHQGESVPLEEGLPDFHPPPLPQE
DPYCLDDAPPNLGYLVRMQGGVLFVYDNQTMLERQEPHSLPYPDLETYIVDMSHILALIT
DGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQ
KHLLRFIKYTYQTEPDRTVAEKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHGF
DKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRS
PKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPSFGKMLENIFLPLFQATIN
PQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANI
MVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQ
IPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVW
KLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETL
CNELSFLSDAMKSEEITALAD
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgcgcgcgcccgtgtgtgttgggaggggcgggaaggtgattcaagggaccagttcaaca
cctggagaacaccaacgcttgctggtcggtttagctaccaagaccgagatgcctcgccaa
ttccccaagttgaacatgtccgatttggacgaacatgtccggctgttggcagagaaggtg
ttcgctaaggtgctccgagaagaggacagcaaagatgttatgtccctgtttactgtcccc
aaggactgtcccatcggacagaaggaagccaaggagagggagctacagaaggagttggca
gagcagaagtctgtggagacagcaaaaagaaagaagagtttcaagatgatccggtcgcag
tctatgtccctgcagatgccaacacaagactggaaaggtcctccatctgtcagtccggcc
atgtctcctacaacccctctggtccttggagctgcttctaagcctgggctggcaccctat
gacatgcctgagtatcagcgagccaccatcagtggagattactgtgcagggatcactatg
gaagactatgaacaggctgccaagagcctggccaaggccctgatgatccgggagaagtat
gcacggcttgcctatcaccgcttcccgcggaccacagcccagtacctggctcatcagggg
gaaagtgtgcctttggaagagggtctcccagacttccaccctcccccactgccccaggaa
gacccttattgcctggacgatgcgccccccaacctgggctacctggtccgcatgcaggga
ggtgttctctttgtgtatgacaatcagacgatgttggaacgccaggaaccccacagcctg
ccctaccctgacctggagacctacatcgtggacatgagccatattctggcactcatcacc
gatggccccacgaaaacctattgtcaccggcgactgaactttctggaatccaagtttagc
cttcatgagatgttaaatgaaatgtcagagttcaaggaattgaagagtaatccccacaga
gacttttataatgtgagaaaggtagacacacacatccatgcagcggcctgcatgaatcag
aagcacctgctgcgtttcatcaagtacacataccagacagagccggacagaactgtggcc
gagaagctcggccggaagatcaccctgcggcaggtgtttgacagcctgcacatggacccc
tacgacctcacagtggactcgctggatgttcatgcgggccggcagacatttcacggcttc
gacaagttcaactccaagtacaaccctgtgggggccagtgagcttcgggacctgtattta
aaaactgaaaactacctggggggagagtactttgctcgcatggtcaaggaagtggcccgg
gaattggaggacagcaagtaccagtactcagaaccccggctgtccatctatggtcgcagt
cctaaggaatggtctagcctggcccgctggttcattcagcacaaggtctactcgcccaac
atgcgttggatcatccaggtgccgcggatctatgatatatttaggtcaaagaaactactg
ccaagctttgggaagatgctggagaacatcttcctgccccttttccaggctactatcaac
cctcaagaccatcgggagcttcacctcttccttaaatacgtgacagggtttgacagcgtg
gatgatgagtccaagcacagtgaccacatgttctcagacaagagccccagcccagacctc
tggaccagcgagcagaacccaccctacagttactacctgtactacatgtatgccaacatc
atggtgctgaacaacctccgcagggaacgaggcctgagcacattcttgttccgacctcac
tgtggggaagccggctccatcactcacctagtgtctgccttcctgactgcagacaacatt
tcccacgggctgctcctcaagaagagtcctgttttgcagtatctctactaccttgctcag
attcctattgccatgtctcctctcagcaacaacagcctgtttctggaatattccaagaac
ccacttcgggaattcctacacaagggattacacgtctctctctctactgatgaccccatg
cagttccactacaccaaggaagcgctcatggaggagtacgccatcgcagcccaagtgtgg
aagttgagtacgtgtgacctgtgtgagattgccaggaacagcgtgctgcagagcggcctc
tcacatcaggagaagcagaagtttttgggtcagaattattacaaggagggaccggagggc
aatgacatccgaaagacaaatgttgcacagatccggatggctttccgctacgagaccctg
tgtaacgagctcagctttctgtccgatgccatgaagtcagaggagatcacagccctggcg
gactag

DBGET integrated database retrieval system