KEGG   Rattus norvegicus (rat): 25096
Entry
25096             CDS       T01003                                 

Gene name
Pld1, Pld1a, Pld1b, Plda, Pldb
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno01100  Metabolic pathways
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04912  GnRH signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05200  Pathways in cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    25096 (Pld1)
   00565 Ether lipid metabolism
    25096 (Pld1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25096 (Pld1)
   04072 Phospholipase D signaling pathway
    25096 (Pld1)
   04071 Sphingolipid signaling pathway
    25096 (Pld1)
   04024 cAMP signaling pathway
    25096 (Pld1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25096 (Pld1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    25096 (Pld1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    25096 (Pld1)
   04928 Parathyroid hormone synthesis, secretion and action
    25096 (Pld1)
  09156 Nervous system
   04724 Glutamatergic synapse
    25096 (Pld1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25096 (Pld1)
   05231 Choline metabolism in cancer
    25096 (Pld1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    25096 (Pld1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     25096 (Pld1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    25096 (Pld1)
 Endosome - Golgi transport
  Others
   Others
    25096 (Pld1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH
Other DBs
NCBI-GeneID: 25096
NCBI-ProteinID: NP_112254
RGD: 3349
Ensembl: ENSRNOG00000028156
UniProt: P70496
Position
2q24
AA seq 1036 aa
MSLRSEARVNTSTLQKIAADMRNLIENLDTRELHFEGEEVEYDASPGDPTAQEACIPFSS
IYNTQGFKEPNIQIYLSGCPVKAQVLEVERFTSTSRMPSVNLYTIELTHGEFTWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRR
KQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNC
CGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRIKVGKKETETKYGLRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTDFLKDHRFGSYAAVHENILAKWYVNAKG
YFEDIANAMEGATEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGQSLGSLTAASVESMESLSLKDKHQSHKNEPVLKS
VNDTDMKLKGIGKSRKFSKFSLYRQLHRRNLHNSDSISSVDSASNTGSIRSVQTGVGELH
GETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFI
QRWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVHAKAQLLRSAADWSAGIKXH
EESIHAAYTHVIENSKHYIYIENQFFISCADDKVVFNKVGNAIAQRILKAHREGQRYRVY
IVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGL
RTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDRQTVP
SVMDGKEYQAGRFAQGLRLECFRLVLGYLSDPSEDIQDPVSDKFFKEIWVSTAARNATIY
DKVFRCLPNDEVHNLIQLRDFINKPILAKEDRLRAEEELRKIRGFLVQFPFYFLSEENLL
PSVGTKEAIVPMEVWT
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgtcactaagaagtgaggcccgggtgaacacttctacactgcagaagatcgccgcagat
atgagaaacctgatagaaaatctcgacacccgggaacttcattttgagggagaggaggtg
gagtatgatgcatctccaggagaccccacggctcaggaagcgtgcatcccattctcttct
atttacaacactcaaggatttaaggagcccaacatccagatctacctctctggctgtcct
gtaaaagcacaagtactggaagtggagcgcttcacgtcgacctcgaggatgccaagtgtc
aacctgtacaccatcgagttaacacacggggaattcacatggcaagttaagaggaaattc
aagcacttccaagagtttcatagagagctcctcaagtacaaagccttcatccggatcccc
attcccaccaaaagacatacgtttagaagacaaaatgtcaaagaagagcccagagaaatg
cccagtctgccccgttcatcagaaaatgcaatccaggaggagcagttctttggcaggagg
aagcaactggaagattacttgacaaaaatactaaaaatgcccatgtacagaaactatcat
gccacgacagagttccttgatgtaagccaactgtcttttatccatgatttgggaccaaag
ggcctggaaggaatgatcatgaaaagatctgggggacacaggataccaggtgtgaattgc
tgtggccatggaagagcctgctaccggtggtcaaagaggtggttgatagtgaaagactct
ttcctgctgtatatgaaaccagacagcggggcgatcgccttcgtccttcttgtagacaaa
gaattcagaatcaaagtgggaaagaaggagacagaaacgaaatatggacttcgaattgat
aatctttcaaggacactgattttaaaatgtaacagctacagacatgcccggtggtgggga
ggcgccatcgaggagttcatccagaagcacggcactgacttcctcaaagaccatcgcttc
ggctcctacgctgcggtccacgagaacattttagctaaatggtacgtgaacgccaaaggt
tactttgaagatatcgcaaacgcaatggaaggggcaacggaagagatttttatcacagat
tggtggttaagtccagaaatcttcctgaagcgcccagtggtggaaggcaaccgctggagg
ctggactgcatcctcaaacggaaagcacaacaaggtgtgcggattttcataatgctttac
aaagaggtggagctagccctcgggatcaacagcgagtacaccaagcggactttgatgcgg
ctgcaccccaacataaaggtgatgagacacccagaccatgtgtcctccagtgtgtatctg
tgggctcatcacgagaagctcgtcattatcgaccaatcggtggcgtttgtgggtgggatt
gacctggcctatggacggtgggatgacaatgagcacagactcacagatgtgggcagtgtc
aagcgggtcacctcaggacagtctctgggctctctcacagcagcatcagtagagtctatg
gaatccttaagcctcaaggacaaacatcaatctcataaaaacgagcccgtcttaaagagt
gtcaacgataccgacatgaaactgaaaggcatagggaagtccaggaaattctccaaattt
agcctctatcgccaacttcaccgccgtaatctgcacaactcggacagcattagcagcgtc
gacagcgcctccaacaccggctccatccgaagtgtgcagacaggagtgggagagctccat
ggggagactaggttttggcatgggaaggattactgcaactttgtcttcaaggactgggtt
caactggacaaaccttttgctgatttcatcgacaggtactccaccccccggatgccttgg
catgacattggttctgtggttcacggaaaggcagctcgtgacgtggctcgacacttcatc
cagcgctggaacttcacaaagattatgaagccaaaatatcgttccctttcttatcctttc
ctgctcccaaagtctcaagccacagcgcatgagctgaggtatcaggtgccaggggccgtc
cacgccaaagcgcagttgctccgatctgctgctgactggtctgctggtataaagcancac
gaggaatctatccatgctgcctacacccatgtcatagagaacagcaagcactacatctat
attgaaaaccaatttttcataagctgcgctgatgataaagtcgtgttcaacaaggtgggc
aatgctatcgcccagagaatcctgaaagcccacagggaaggccagagatatcgagtgtac
atcgtgataccactgctgccgggattcgaaggagacatttccacaggcgggggaaatgcc
ctacaggcaataatgcacttcaactacagaaccatgtgcagaggggagagctccatcctt
gaacagttaaagccagagcttggtaacaagtggataaattacatatcattttgcggtctg
agaacacatgcagagctggaaggaaaccttgtcactgagctcatctatgtccacagcaag
ttgttaattgctgatgataacacggttatcataggttctgccaacatcaatgaccggagc
atgctgggaaagcgagacagcgaaatggctgtcatagtgcaggacagacagacagtcccg
tcagtgatggatggaaaagaatatcaagctggccgcttcgctcaaggccttcggctggag
tgcttcaggcttgtcctgggttatctttctgacccaagtgaggacattcaggatcctgta
agtgacaaattcttcaaggagatttgggtttcaacggcagctcgaaatgctaccatatat
gataaggtcttccggtgccttcccaatgacgaagtgcacaatttaatccagttgcgggac
tttataaacaagcctatattggcaaaagaggaccgccttcgtgccgaggaagaactgagg
aagatccgtggcttcttggtgcagttccccttctacttcttatcagaagaaaacctgctg
ccttccgttggaaccaaggaagccattgtgcccatggaggtttggacttaa

DBGET integrated database retrieval system