KEGG   Rattus norvegicus (rat): 25100Help
Entry
25100             CDS       T01003                                 

Gene name
Foxa3, Hnf3g
Definition
(RefSeq) forkhead box A3
  KO
K08038  forkhead box protein A3, hepatocyte nuclear factor 3-gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    25100 (Foxa3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25100 (Foxa3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix tissue-specific regulators
    25100 (Foxa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead Forkhead_N HNF_C Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 25100
NCBI-ProteinID: NP_058773
RGD: 2809
Ensembl: ENSRNOG00000014256
UniProt: P32183
Position
1q21
AA seq 354 aa AA seqDB search
MLGSVKMEAHDLAEWSYYPEAGEVYSPVNPVPTMAPLNSYMSLNPLSSPYPPGGLQASPL
PTGPLAPPAPTAPLGPTFPGLGAGSGTGGSASGYGAPGPGLVHGKEMAKGYRRPLTHAKP
PYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKV
ARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKAKKGNSATSATRNGTVGSAT
SATTTAATAVTSPAQPQPTPPSEPEAQSGEDVGGLDCASPPSSAPYFTGLELPGELKLDA
PYNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLLNAS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgggctcagtgaagatggaggcccatgacctggccgagtggagctactacccggag
gcgggcgaggtgtattctccagtgaatcctgtgcccaccatggcccctctcaactcctac
atgtccttgaaccctcttagctctccctaccctcccggagggcttcaggcctcccctctg
cctacaggacccctggcacccccagcccccaccgctcccctggggcccaccttcccaggc
ctgggcgcaggcagcggcaccggaggcagtgcttccgggtatggcgccccagggcccggg
cttgtacacggaaaggaaatggccaaggggtaccggcggccactgactcatgccaaacca
ccttattcctacatctctctcatcaccatggctatccagcaggcaccaggcaagatgctg
accctgagtgaaatctaccaatggatcatggacctcttcccgtactaccgggagaaccag
caacgttggcagaactccatccggcactcgctgtccttcaatgactgcttcgtcaaggtg
gcacgctccccagacaaaccgggcaaaggctcctactgggccttgcatcccagctctggg
aacatgtttgagaacggctgctatctccgccgtcagaagcgcttcaagctggaggagaag
gcaaagaaaggaaacagtgccacatccgccaccaggaatggaacagtggggtcagccacc
tctgccaccactacagctgccactgcagtcacttccccggctcagccccagcctacgccg
ccgtctgagcccgaggcccagagtggggaagatgtggggggtctggactgcgcctcgcct
ccttcatccgcaccctatttcactggcctggagctcccaggggaactgaagttggatgcg
ccctacaacttcaaccaccctttctctatcaacaacctgatgtcagaacagacatcaaca
ccttccaaactagatgtggggtttgggggctacggtgctgagagtggggaacctggggtc
tactaccagagcctctattcccgctctctgctcaatgcatcctag

DBGET integrated database retrieval system