KEGG   Rattus norvegicus (rat): 25102
Entry
25102             CDS       T01003                                 

Gene name
Chrna5
Definition
(RefSeq) cholinergic receptor nicotinic alpha 5 subunit
  KO
K04807  nicotinic acetylcholine receptor alpha-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25102 (Chrna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25102 (Chrna5)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   25102 (Chrna5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 25102
NCBI-ProteinID: NP_058774
RGD: 2347
Ensembl: ENSRNOG00000013610
Vega: OTTRNOG00000002261
Position
8q24
AA seq 467 aa
MAVRGSRRRALRLLLMVQLLAGRWRPTGAARGTRGGLPELSSAAKHEDSLFRDLFEDYER
WVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKI
IRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYI
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKL
PKLLCMRSHADRYFTQREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWK
FIAQVLDRMFLWTFLLVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcggtgcgggggtcgcggcggcgcgcgctgcgcctgctcttgatggtgcagctgctg
gcagggcgctggcggccgaccggggcggcgcggggcacgcggggagggttgcctgaacta
tcctctgctgccaaacatgaagacagcttgtttagggatttatttgaagactacgaaagg
tgggttcgccctgtggaacacctgagcgacaagataaaaatcaagtttggccttgcgata
tctcagttagtggacgtggatgagaaaaaccagctgatgacgacgaacgtctggttgaag
caggaatggatagatgtgaaattgagatggaatcctgacgattatggtgggataaagatt
atacgtgttccttcggactccctgtggatcccagacatcgttttgttcgataatgcagat
ggacgttttgaaggggccagcacgaaaacagttgtcaggtacaacggcactgtcacgtgg
acgcaaccagcaaactacaaaagttcttgcaccatcgacgttacctttttcccgtttgat
ctccaaaattgttccatgaaattcggctcgtggacatacgatggatcccaggttgatata
atcctagaggaccaagatgtcgacagaacagactttttcgacaatggagagtgggaaatc
atgagcgcgatggggagcaaggggaaccggacggacagctgctgctggtacccctacatc
acgtactcctttgtgattaagcggctgcctctcttctataccttgtttcttattatcccc
tgcattgggctctcatttctgactgtggttgtcttctatctcccttcaaacgagggtgaa
aagattagcctctgcacctcagtgctcgtctctctgactgtcttccttttggtaatcgaa
gagatcataccgtcatcttccaaagtcatacccctgattggggagtacttggtgttcacc
atgattttcgtgaccctatccattatggtgactgtctttgccatcaacatccaccaccgc
tcttcctccacacacaacgctatggcgccctgggttcgtaagatatttctccacaagctt
cccaagctgctctgcatgagaagtcatgcggataggtacttcactcagagagaagaagcc
gagagtggggctggacctaaatctcggaacactttggaagccgcactcgattgcattcgc
tacatcacgaggcacgtcgtgaaagagaacgacgtccgcgaggttgttgaagattggaaa
ttcatagcccaagtccttgatcggatgtttttgtggacgtttcttctggtgtcaatcatt
gggactttagggctttttgttcctgttatttataaatgggccaatataatagtcccagtt
cacattggaaacacaattaagtga

DBGET integrated database retrieval system