KEGG   Rattus norvegicus (rat): 25103
Entry
25103             CDS       T01003                                 

Gene name
Chrnb4
Definition
(RefSeq) cholinergic receptor nicotinic beta 4 subunit
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25103 (Chrnb4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    25103 (Chrnb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25103 (Chrnb4)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   25103 (Chrnb4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 25103
NCBI-ProteinID: NP_434693
RGD: 2351
Ensembl: ENSRNOG00000014427
Vega: OTTRNOG00000002264
UniProt: P12392
Position
8q24
AA seq 495 aa
MRGTPLLLVSLFSLLQDGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELS
LSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNA
DGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEI
DMVLKSPTAIMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLII
PCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLF
TMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSLVRVPH
PSQLHLATADTAATSALGPTSPSNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSS
GRFREDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGL
FLPPLFQIHAPSKDS
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaggggtacgcccctgctcctcgtctctctgttctctctgcttcaggacggggactgc
cgcctggccaacgcagaggagaagctgatggatgacctcctgaacaaaacccggtacaac
aacctgatccgcccagccaccagctcctctcagctcatctccatccgcctggagctatca
ctgtcccagctcatcagtgtgaatgagcgagaacagatcatgaccaccagcatctggctg
aaacaggaatggactgactaccgcctggcctggaacagctcctgctatgaaggggtgaac
attctgaggatccccgcaaagcgtgtctggttgcctgacatcgtgttgtacaacaatgcc
gatggcacctatgaggtgtctgtctacaccaacgtgattgtgcgttccaatggcagcatc
cagtggctgccccctgctatctacaagagtgcctgcaagattgaggtgaagcactttccc
ttcgaccagcagaactgcaccctcaaattccgctcctggacctatgaccacacggagatt
gacatggttcttaagtcgcccacggccatcatggatgacttcacccccagtggtgaatgg
gacattgtggccctcccaggacggaggacggtgaaccctcaggaccccagctacgtggac
gtgacctatgacttcatcatcaagcgcaagccgctcttctacaccatcaatcttatcatt
ccttgtgtgctcatcacctcgctggctatcctggtcttctacctgccctccgactgtggg
gagaagatgacgctctgcatctctgtgctgctggcactcacgttcttcctgctgctcatc
tccaagatcgtgcctcccacctcccttgacataccgctcattggcaagtacctcttgttc
accatggtgctggtcaccttttccatcgtcaccactgtgtgtgtcctcaatgtgcaccac
cgctcacccagcactcacaccatggcatcctgggtcaaggagtgcttcctgcacaaactg
cccaccttcctcttcatgaagcgtcccggtcttgaagtcagcctggtcagggtccctcat
cccagccagctgcacttggccacagctgatactgcagccacctctgccttaggccccacc
agcccatccaacctctatgggagttccatgtactttgtgaaccctgtccctgccgctcct
aagtctgcagtcagctcccacacagcaggcctccccagggatgcccgtctgaggtcctcc
gggaggttccgggaagatctacaggaagcattagagggtgtcagcttcatcgcccagcat
ctggagagcgatgaccgagatcaaagtgtcatcgaggactggaagttcgtcgcgatggtt
gttgaccgcctgttcctgtgggtgttcgtgtttgtgtgtattctgggcaccatggggctc
ttcctgccaccccttttccagatccacgcaccctccaaggactcctag

DBGET integrated database retrieval system