KEGG   Rattus norvegicus (rat): 25105Help
Entry
25105             CDS       T01003                                 

Gene name
Nppb, BNP, Bnf
Definition
(RefSeq) natriuretic peptide B
  KO
K12335  natriuretic peptide B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    25105 (Nppb)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25105 (Nppb)
  09159 Environmental adaptation
   04714 Thermogenesis
    25105 (Nppb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANP
Motif
Other DBs
NCBI-GeneID: 25105
NCBI-ProteinID: NP_113733
RGD: 3194
Ensembl: ENSRNOG00000008141
UniProt: P13205
Position
5q36
AA seq 121 aa AA seqDB search
MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQL
SKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRL
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggatctccagaaggtgctgccccagatgattctgctcctgcttttccttaatctgtcg
ccgctgggaggtcactcccatcccctgggaagtcctagccagtctccagaacaatccacg
atgcagaagctgctggagctgataagagaaaagtcagaggaaatggctcagagacagctc
tcaaaggaccaaggccctacaaaagaacttctaaaaagagtccttaggtctcaagacagc
gccttccggatccaggagagacttcgaaattccaagatggcacatagttcaagctgcttt
gggcagaagatagaccggatcggcgcagtcagtcgcttgggctgtgacgggctgaggttg
ttttag

DBGET integrated database retrieval system