KEGG   Rattus norvegicus (rat): 25105
Entry
25105             CDS       T01003                                 

Gene name
Nppb, BNP, Bnf
Definition
(RefSeq) natriuretic peptide B
  KO
K12335  natriuretic peptide B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    25105 (Nppb)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25105 (Nppb)
  09159 Environmental adaptation
   04714 Thermogenesis
    25105 (Nppb)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 25105
NCBI-ProteinID: NP_113733
RGD: 3194
Ensembl: ENSRNOG00000008141
UniProt: P13205
Position
5q36
AA seq 121 aa
MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQL
SKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRL
F
NT seq 366 nt   +upstreamnt  +downstreamnt
atggatctccagaaggtgctgccccagatgattctgctcctgcttttccttaatctgtcg
ccgctgggaggtcactcccatcccctgggaagtcctagccagtctccagaacaatccacg
atgcagaagctgctggagctgataagagaaaagtcagaggaaatggctcagagacagctc
tcaaaggaccaaggccctacaaaagaacttctaaaaagagtccttaggtctcaagacagc
gccttccggatccaggagagacttcgaaattccaagatggcacatagttcaagctgcttt
gggcagaagatagaccggatcggcgcagtcagtcgcttgggctgtgacgggctgaggttg
ttttag

DBGET integrated database retrieval system