KEGG   Rattus norvegicus (rat): 25106
Entry
25106             CDS       T01003                                 

Gene name
Rgn, GNL, Rc, Reguc
Definition
(RefSeq) regucalcin
  KO
K01053  gluconolactonase [EC:3.1.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00030  Pentose phosphate pathway
rno00053  Ascorbate and aldarate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    25106 (Rgn)
   00053 Ascorbate and aldarate metabolism
    25106 (Rgn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25106 (Rgn)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.17  gluconolactonase
     25106 (Rgn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25106 (Rgn)
SSDB
Motif
Pfam: SGL NHL Lactonase Reg_prop
Other DBs
NCBI-GeneID: 25106
NCBI-ProteinID: NP_113734
RGD: 3560
Ensembl: ENSRNOG00000007949
UniProt: Q03336
Position
Xq11
AA seq 299 aa
MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSS
VALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAE
ETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDY
DLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKL
PVDKTTSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtcttccatcaagattgaatgtgttttaagggagaactacaggtgtggggagtcccct
gtgtgggaggaggcatcaaagtgtctgctgtttgtagacatcccttcaaagactgtctgc
cgatgggattcgatcagcaatcgagtgcagcgagttggtgtagatgccccagtcagttca
gtggcacttcgacagtcaggaggctatgttgccaccattggaaccaagttctgtgctttg
aactgggaagatcaatcagtatttatcctagccatggtggatgaagataagaaaaacaat
cgattcaatgatgggaaggtggatcctgctgggagatactttgctggtaccatggctgag
gaaacggccccagctgttctggagcggcaccaagggtccttgtactccctttttcctgat
cacagtgtgaagaaatactttgaccaagtggatatctccaatggtttggattggtccctg
gaccataaaatcttctactacattgacagcctgtcctacactgtggatgcctttgactat
gacctgccaacaggacagatttccaaccgcagaactgtttacaagatggaaaaagatgaa
caaatcccagatggaatgtgcattgatgttgaggggaagctttgggtggcctgttacaat
ggaggaagagtaattcgcctagatcctgagacagggaaaagactgcaaactgtgaagttg
cctgttgataaaacaacttcatgctgctttggagggaaggattactctgaaatgtacgtg
acatgtgccagggatgggatgagcgccgaaggtcttttgaggcagcctgatgctggtaac
attttcaagataacaggtcttggggtcaaaggaattgctccatattcctatgcagggtaa

DBGET integrated database retrieval system