KEGG   Rattus norvegicus (rat): 25107
Entry
25107             CDS       T01003                                 

Gene name
Avpr1a
Definition
(RefSeq) vasopressin V1a receptor
  KO
K04226  arginine vasopressin receptor 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25107 (Avpr1a)
   04072 Phospholipase D signaling pathway
    25107 (Avpr1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25107 (Avpr1a)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25107 (Avpr1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25107 (Avpr1a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Vasopressin
    25107 (Avpr1a)
SSDB
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 25107
NCBI-ProteinID: NP_444178
RGD: 2185
Ensembl: ENSRNOG00000004400
UniProt: P30560
Position
7
AA seq 424 aa
MSFPRGSQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAKLEIAVLAV
IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP
DWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFI
LSTPQYFIFSVIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSGVFVAPVVVLGTCYGF
ICYHIWRNIRGKTASSRHSKGDKGSGEAVGPFHKGLLVTPCVSSVKSISRAKIRTVKMTF
VIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH
LLQDCVQSFPCCHSMAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGMWKDSPKSSKSIRFI
PVST
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtttcccgcgaggctcccaggatcggtccgtgggcaactccagcccgtggtggcct
ctaaccaccgagggctccaacggcagtcaggaggcagccaggcttggggaaggtgacagc
ccgctgggggacgtacgcaatgaggagctggccaaactggaaatcgctgtgctggcagtg
atttttgtggtggctgtgctgggcaatagcagtgtgctgctggcgctgcatcgcacgcca
cgcaagacatcccgcatgcacctctttatccgacacctcagcctggcagacctggcggtc
gccttcttccaagtattaccgcagctatgctgggacatcacctaccgcttccgcgggccg
gactggctgtgccgcgtggtgaagcacctgcaggtgtttgccatgttcgcgtctgcctat
atgctggtggtgatgacagccgaccgctacatcgccgtgtgccacccgctcaagaccctg
cagcagccggcgcgccgctcgcgcctcatgatcgccacctcttgggtgctgagtttcata
ctaagcacgccacagtactttatattctctgtgatcgaaatcgaggtgaacaatggcact
aaaacccaagactgctgggctaccttcatccagccctggggtacccgcgcctacgtgacc
tggatgaccagcggtgtcttcgtggcacctgtggtcgtcttgggtacatgctatggcttc
atctgctaccacatctggcgcaacatccgcggaaagacagcgtcctcgcgacacagcaag
ggtgacaagggctctggggaggccgtgggtccctttcataaggggcttttggttacacct
tgtgtcagcagcgtgaagagcatttcccgcgccaagatccgcactgtgaagatgaccttt
gtgattgtaagcgcctacatcctttgctgggcgcctttcttcattgtccagatgtggtca
gtctgggatgagaatttcatctggaccgattcagaaaacccttccatcacaatcacggcg
ttgctggcttccttgaacagctgctgcaacccgtggatatacatgtttttcagtggccat
ctcctgcaagactgcgtccaaagtttcccatgctgccacagcatggcgcagaaattcgcc
aaggatgactccgatagcatgagccgaagacagacttcttattctaacaaccggagccca
acgaacagcactgggatgtggaaggactcgcccaaatcttccaaatccatcagattcatt
cctgtctccacttga

DBGET integrated database retrieval system