KEGG   Rattus norvegicus (rat): 25107
Entry
25107             CDS       T01003                                 
Symbol
Avpr1a
Name
(RefSeq) vasopressin V1a receptor
  KO
K04226  arginine vasopressin receptor 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25107 (Avpr1a)
   04072 Phospholipase D signaling pathway
    25107 (Avpr1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25107 (Avpr1a)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25107 (Avpr1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25107 (Avpr1a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Vasopressin
    25107 (Avpr1a)
SSDB
Motif
Pfam: 7tm_1 V1R_C 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 25107
NCBI-ProteinID: NP_444178
RGD: 2185
Ensembl: ENSRNOG00000004400
UniProt: P30560
Position
7:58114306..58118230
AA seq 424 aa
MSFPRGSQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAKLEIAVLAV
IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP
DWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFI
LSTPQYFIFSVIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSGVFVAPVVVLGTCYGF
ICYHIWRNIRGKTASSRHSKGDKGSGEAVGPFHKGLLVTPCVSSVKSISRAKIRTVKMTF
VIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH
LLQDCVQSFPCCHSMAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGMWKDSPKSSKSIRFI
PVST
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtttcccgcgaggctcccaggatcggtccgtgggcaactccagcccgtggtggcct
ctaaccaccgagggctccaacggcagtcaggaggcagccaggcttggggaaggtgacagc
ccgctgggggacgtacgcaatgaggagctggccaaactggaaatcgctgtgctggcagtg
atttttgtggtggctgtgctgggcaatagcagtgtgctgctggcgctgcatcgcacgcca
cgcaagacatcccgcatgcacctctttatccgacacctcagcctggcagacctggcggtc
gccttcttccaagtattaccgcagctatgctgggacatcacctaccgcttccgcgggccg
gactggctgtgccgcgtggtgaagcacctgcaggtgtttgccatgttcgcgtctgcctat
atgctggtggtgatgacagccgaccgctacatcgccgtgtgccacccgctcaagaccctg
cagcagccggcgcgccgctcgcgcctcatgatcgccacctcttgggtgctgagtttcata
ctaagcacgccacagtactttatattctctgtgatcgaaatcgaggtgaacaatggcact
aaaacccaagactgctgggctaccttcatccagccctggggtacccgcgcctacgtgacc
tggatgaccagcggtgtcttcgtggcacctgtggtcgtcttgggtacatgctatggcttc
atctgctaccacatctggcgcaacatccgcggaaagacagcgtcctcgcgacacagcaag
ggtgacaagggctctggggaggccgtgggtccctttcataaggggcttttggttacacct
tgtgtcagcagcgtgaagagcatttcccgcgccaagatccgcactgtgaagatgaccttt
gtgattgtaagcgcctacatcctttgctgggcgcctttcttcattgtccagatgtggtca
gtctgggatgagaatttcatctggaccgattcagaaaacccttccatcacaatcacggcg
ttgctggcttccttgaacagctgctgcaacccgtggatatacatgtttttcagtggccat
ctcctgcaagactgcgtccaaagtttcccatgctgccacagcatggcgcagaaattcgcc
aaggatgactccgatagcatgagccgaagacagacttcttattctaacaaccggagccca
acgaacagcactgggatgtggaaggactcgcccaaatcttccaaatccatcagattcatt
cctgtctccacttga

DBGET integrated database retrieval system