KEGG   Rattus norvegicus (rat): 25108Help
Entry
25108             CDS       T01003                                 

Gene name
Avpr2
Definition
(RefSeq) arginine vasopressin receptor 2
  KO
K04228  arginine vasopressin receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    25108 (Avpr2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25108 (Avpr2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    25108 (Avpr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25108 (Avpr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Vasopressin
    25108 (Avpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Git3
Motif
Other DBs
NCBI-GeneID: 25108
NCBI-ProteinID: NP_062009
RGD: 2186
Ensembl: ENSRNOG00000059862
UniProt: Q00788
Position
Xq37
AA seq 371 aa AA seqDB search
MLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG
ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ
RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP
SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA
PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT
ASSSLMKDTPS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggtgtctaccgtgtccgctgtgcctgggctcttttcaccccctagctctccc
agcaacagcagccaggaggaactactggatgaccgagacccgctgctagtccgggctgaa
ctggccctgctatctacaatttttgtggctgtggccttgagcaatggcctagtgctgggg
gccctaatacggcggggccggcgtggacgctgggcacccatgcatgtcttcatcagtcat
ttgtgcctggctgacctggctgtggctctgtttcaagtgctaccccagctggcttgggat
gccactgaccgcttccatggccctgatgccctgtgtcgggccgtcaagtacctgcagatg
gtgggcatgtatgcctcctcctacatgatcctggccatgacactagaccgccatcgtgcc
atctgccgccctatgctagcataccgccatggaggtggggctcgctggaacaggccagtg
ctggtggcctgggccttctcactccttctcagcctgcctcagctcttcatctttgctcag
cgtgatgtgggaaatggcagtggggtgtttgattgctgggcccgatttgcagaaccatgg
ggccttcgtgcctatgtcacctggattgccttgatggtgtttgtggcacctgccctaggc
attgctgcctgtcaggttcttatcttccgggagatacacgccagtctggtgccagggcca
tccgagagggcagggaggcgccgcagagggcgccggacaggaagccccagcgagggagca
catgtatcagcagccatggccaagaccgtgaggatgacactggtgattgtgattgtctac
gtgctatgctgggcacccttcttcctcgtgcagctgtgggcagcgtgggatccggaagct
cctctggaaagacccccctttgtgttgctcatgctgctggctagccttaacagctgtacc
aacccttggatctatgcttccttcagtagcagtgtctcctcggagttgcgtagcctgctt
tgctgtgctcagaggcacaccacacacagcctgggtcctcaagatgaatcctgtgccaca
gccagctcctctttgatgaaggatacaccctcctga

DBGET integrated database retrieval system