KEGG   Rattus norvegicus (rat): 25109Help
Entry
25109             CDS       T01003                                 

Gene name
Cd1d1, Cd1, Cd1d
Definition
(RefSeq) CD1d1 molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno04640  Hematopoietic cell lineage
rno05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25109 (Cd1d1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25109 (Cd1d1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25109 (Cd1d1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25109 (Cd1d1)
CD molecules [BR:rno04090]
 Proteins
  25109 (Cd1d1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 Phage_holin_3_6 Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 25109
NCBI-ProteinID: NP_058775
RGD: 2296
Ensembl: ENSRNOG00000016451
UniProt: Q63493
Position
2q34
AA seq 336 aa AA seqDB search
MLYLPCLLLWAFPQFWGQSEVQQNYTFGCLQISSFANRSWSRTDSVVWLGDLQTHRWSND
SDTISFTKPWSQGKFSNQQWEKLQHMFQVYRTSFTRDIKEIVKMMSPKEDYPIEVQLSAG
CEMYPGNASESFLHVAFQGEYVVRFHGTSWQKVPEAPSWLDLPIKMLNADEGTRETVQIL
LNDTCPQFVRGLLEAGKPDLEKQEKPVAWLSRGPNPAHGHLQLVCHVSGFHPKPVWVMWM
RGDQEQGGTHRGDILPNADETWYLQATLDVEAGDEAGLACRVKHSSLEGQDIILYWGGRQ
VSPVLIFLIVGVLVLVVCAVAYYIIRKRRRSYQDIM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacctaccgtgcctgttgctgtgggcattcccacagttctggggacaatccgaa
gtccagcagaattacaccttcggctgcctgcagatctcttccttcgccaaccgaagctgg
tcccgcacagacagtgtggtctggctgggggatctgcagacacaccgttggagtaatgac
tcagacaccatcagcttcacaaagccgtggtcccagggcaaattcagtaaccagcagtgg
gagaagttgcagcatatgtttcaagtgtatcgaaccagctttaccagggacatcaaggaa
atagtcaaaatgatgtcacctaaagaagactatcctatcgaggtccaactgtctgctggc
tgtgaaatgtaccctgggaatgcttcagaaagctttttacacgtagcatttcaaggagaa
tatgtcgtgagattccatggaacatcctggcagaaggtcccagaggccccatcttggtta
gatttgcccatcaaaatgctcaacgctgatgaaggaacgagagaaacagtgcagatactc
ctgaacgacacctgcccccagtttgtccgtggcctcctagaagcagggaagccagaccta
gaaaagcaagagaagccagtggcctggttatcccgtggccccaaccctgcccatggccat
ctgcagctggtatgtcatgtctctggcttccacccaaagcctgtgtgggtgatgtggatg
cggggtgaccaggagcaagggggtactcacagaggtgacatcctgccaaatgcggatgag
acatggtatcttcaagcaaccctggatgtggaggctggagacgaggctggcctggcctgc
agggtgaagcacagcagtctagaggggcaggacatcatcctctactggggtggcagacaa
gtatccccggtgttgatcttcttgatagtaggcgtactggttctagtggtgtgtgctgtg
gcctactatatcatcaggaaaaggagacgctcctatcaagacatcatgtga

DBGET integrated database retrieval system