KEGG   Rattus norvegicus (rat): 25110Help
Entry
25110             CDS       T01003                                 

Gene name
Klrd1, Cd94
Definition
(RefSeq) killer cell lectin like receptor D1
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno04650  Natural killer cell mediated cytotoxicity
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25110 (Klrd1)
   04612 Antigen processing and presentation
    25110 (Klrd1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    25110 (Klrd1)
CD molecules [BR:rno04090]
 Proteins
  25110 (Klrd1)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   25110 (Klrd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Peptidase_C41 Ly49
Motif
Other DBs
NCBI-GeneID: 25110
NCBI-ProteinID: NP_036877
RGD: 2978
Ensembl: ENSRNOG00000060246
UniProt: O35778
Position
4q42
AA seq 179 aa AA seqDB search
MAVSRITRWRLMSMFFGIKCLFLIVALGVLVKNSFTIQNIQSTPSSTPIVEFQKVSKCCA
CLEKWIGHQCSCYFISKEEKSWKGSREFCASQNSSLLQLQTRNELSFMSSSQAFFWIGIH
YNEERSAWLWEDGTFPSKDLFPEFSKFRQDHCIGYSISREISSESCENKNRFICKQLPT
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcagtttctaggatcactcgatggaggttgatgtccatgttctttggaataaaatgt
cttttcttgatagttgctttgggagttttggtgaaaaattcatttactatacagaacatt
caatcgacaccttcttcaaccccgatagtagaattccagaaagtttctaaatgctgtgct
tgcctggaaaagtggattgggcatcaatgcagttgttactttatttccaaagaagaaaag
tcctggaaaggaagcagagagttttgtgcttctcagaattccagtcttcttcagctccaa
accagaaatgaattgagttttatgagctccagtcaagcctttttctggattggaatccac
tataatgaagaaagaagtgcctggctatgggaggatggcacatttccctcaaaagattta
tttccagagttctcaaagttcaggcaagaccactgcattggttatagtataagcagagaa
atttcttctgaatcctgtgaaaataaaaaccgttttatctgtaagcaactgcctacttaa

DBGET integrated database retrieval system