KEGG   Rattus norvegicus (rat): 25110
Entry
25110             CDS       T01003                                 

Gene name
Klrd1
Definition
(RefSeq) natural killer cells antigen CD94
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno04650  Natural killer cell mediated cytotoxicity
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25110 (Klrd1)
   04612 Antigen processing and presentation
    25110 (Klrd1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    25110 (Klrd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25110 (Klrd1)
   04091 Lectins [BR:rno04091]
    25110 (Klrd1)
CD molecules [BR:rno04090]
 Proteins
  25110 (Klrd1)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   25110 (Klrd1)
SSDB
Motif
Pfam: Lectin_C Peptidase_C41 Ly49
Other DBs
NCBI-GeneID: 25110
NCBI-ProteinID: NP_036877
RGD: 2978
Ensembl: ENSRNOG00000060246
UniProt: O35778
Position
4
AA seq 179 aa
MAVSRITRWRLMSMFFGIKCLFLIVALGVLVKNSFTIQNIQSTPSSTPIVEFQKVSKCCA
CLEKWIGHQCSCYFISKEEKSWKGSREFCASQNSSLLQLQTRNELSFMSSSQAFFWIGIH
YNEERSAWLWEDGTFPSKDLFPEFSKFRQDHCIGYSISREISSESCENKNRFICKQLPT
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcagtttctaggatcactcgatggaggttgatgtccatgttctttggaataaaatgt
cttttcttgatagttgctttgggagttttggtgaaaaattcatttactatacagaacatt
caatcgacaccttcttcaaccccgatagtagaattccagaaagtttctaaatgctgtgct
tgcctggaaaagtggattgggcatcaatgcagttgttactttatttccaaagaagaaaag
tcctggaaaggaagcagagagttttgtgcttctcagaattccagtcttcttcagctccaa
accagaaatgaattgagttttatgagctccagtcaagcctttttctggattggaatccac
tataatgaagaaagaagtgcctggctatgggaggatggcacatttccctcaaaagattta
tttccagagttctcaaagttcaggcaagaccactgcattggttatagtataagcagagaa
atttcttctgaatcctgtgaaaataaaaaccgttttatctgtaagcaactgcctacttaa

KEGG   Rattus norvegicus (rat): 29683
Entry
29683             CDS       T01003                                 

Gene name
Klrc1
Definition
(RefSeq) killer cell lectin-like receptor subfamily C, member 1
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno04650  Natural killer cell mediated cytotoxicity
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    29683 (Klrc1)
   04612 Antigen processing and presentation
    29683 (Klrc1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    29683 (Klrc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    29683 (Klrc1)
   04091 Lectins [BR:rno04091]
    29683 (Klrc1)
CD molecules [BR:rno04090]
 Proteins
  29683 (Klrc1)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   29683 (Klrc1)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R Colicin_V Ly49
Other DBs
NCBI-GeneID: 29683
NCBI-ProteinID: NP_001032518
RGD: 2976
Ensembl: ENSRNOG00000055196
Position
4
AA seq 236 aa
MSNDRVTYAELNVAKNSRYQHNKPRGSRSSISVIEQEIVYADFSFKNPSQEQTRICRDCH
CKGFPSPPEKLIAGTLGFISFVLIVAVVVITTVATPYTETKAQINSSMTRTYQARPCTRC
PDDWISYSHNCYYISVERKSWNDGLTSCISKNCSLLHIDSEEEQAFLQSFSLVSWTGFFR
KSRSQPWVWENGSTFKPKITEMLHDEYNCIMMSTSGLTAENCTILHPYVCKCKLTN
NT seq 711 nt   +upstreamnt  +downstreamnt
atgagtaatgatcgagtcacctatgcagaactgaatgtggccaagaactcaaggtaccag
cacaacaaaccaaggggcagtcgcagctccatttcagtaatagagcaggaaatcgtttat
gcggatttcagctttaaaaatccttctcaagagcagacccggatctgcagggattgccac
tgcaaaggttttccatctcctccagaaaaactcattgctgggaccctgggcttcatcagt
tttgtcttaattgttgctgtggttgtaattactacagttgccacaccatatactgaaaca
aaggcacagatcaactcctcaatgacgagaacctaccaagcacgaccttgtactcgttgt
ccagatgattggatatcatattcccacaactgttattacattagtgtggagagaaaatct
tggaatgatggtttgacgtcctgcatttccaaaaattgcagtctgcttcacatagatagt
gaagaggagcaggcttttctgcagtccttttcactggtctcatggactggattctttcga
aagagcagaagtcagccctgggtttgggaaaatggctcaactttcaaaccaaagataaca
gagatgctgcatgatgaatataactgtatcatgatgtcaacttctggtctcacggcagaa
aactgtaccattttacatccatatgtttgtaagtgcaaattaaccaactga

KEGG   Rattus norvegicus (rat): 353253
Entry
353253            CDS       T01003                                 

Gene name
Kir3dl1
Definition
(RefSeq) killer cell immunoglobulin-like receptor 3DL1 precursor
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno04650  Natural killer cell mediated cytotoxicity
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    353253 (Kir3dl1)
   04612 Antigen processing and presentation
    353253 (Kir3dl1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    353253 (Kir3dl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    353253 (Kir3dl1)
CD molecules [BR:rno04090]
 Proteins
  353253 (Kir3dl1)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 Ig_4 V-set SID-1_RNA_chan Orf78 DUF4834 Sigma_reg_N Tmemb_9 Adeno_E3_CR1 OAD_gamma DUF5385 DUF5452 ASFV_J13L m04gp34like tRNA_anti-like DUF6377 PspB Amnionless SurA_N_2 DUF975
Other DBs
NCBI-GeneID: 353253
NCBI-ProteinID: NP_852144
RGD: 727836
Ensembl: ENSRNOG00000027843
UniProt: P83556
Position
1
AA seq 422 aa
MMFEFLSLLCSGFFLVQRMSAHMGSYDKPFLCASPSYIVPQGQNVTLICDSHSKPNIFKV
YKEDGFPILQLHEKTFTKSLDIGPVTPEYAGTYRCFHHQYPNEISAHSEPLKIIISGIYM
KPFLIAPQTPLANSGENVTLECHSEIMFDTYILTSHRMEILKETLQHFQESHFSGSYASF
TIGPMTPDHSGTYTCYGAYNHSLYEWSDSSDPVDIKITGEYKKPSLSSVMSPVLVSEQNM
TLSCISNHQFEMFHLSREGVPQGKGIPAMQSHSGKFEAKFLLSPVIQKGNYRCYGSFKNS
SHVWSSPSDPLYLPAKDNLKNLHIQIGLLVTMVLVIVVIIIIIIIIIIIIYYYYFSKKSS
ILEQESEVKATINRQDPERQEEHKVTYIEFEQRIFNKNLMPPISQSPKEFSIDTVVYTEV
MI
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgatgttcgagttcctaagcctactgtgttctggtttcttcctagtccagaggatgtca
gcacacatgggaagttatgataagccttttctctgtgcctcgccaagttatattgttcct
cagggacagaatgtgactcttatttgtgactctcatagtaaacctaacatattcaaggtg
tacaaagaagatgggtttcctatccttcagttacatgagaaaacattcacgaagagcctt
gacattggtcctgtaaccccagaatatgcaggcacctacagatgctttcatcatcaatac
cctaatgaaatttcagcgcatagtgaacctctgaagatcataatttcaggaatctacatg
aagcctttcctcatagctccacaaactcccctggcaaattcaggagagaatgtgaccctg
gagtgtcattcagagattatgtttgatacctacattttgacttcacacagaatggaaata
ctaaaagaaactttgcagcattttcaagaatctcattttagtgggtcttatgccagtttc
acaattggtcccatgacacctgatcacagtggaacatacacgtgctatggtgcttacaat
catagcttatatgagtggtcagactctagtgaccccgttgacatcaagatcacaggtgaa
tacaagaaaccttctctgtcgtctgtgatgagccctgtactggtgtcagaacagaacatg
accctgtcctgcatctctaaccatcagtttgaaatgttccatctgtccagagaaggggtg
cctcaaggaaaagggatacctgcaatgcagagccacagtggtaaatttgaagccaaattc
cttcttagtcctgtgatccaaaaagggaactatagatgctatggctctttcaaaaactct
tcccatgtgtggtcatctccaagtgaccccttgtaccttcctgccaaagataacctcaag
aacctgcacattcaaattgggctcttagtgaccatggtccttgtcatcgtcgtcatcatc
atcatcatcatcatcatcatcatcatcatttattattattacttttccaaaaagagcagc
attttagaacaagagtctgaagttaaagcaacaataaacagacaggatcctgaaagacaa
gaagagcataaggtgacatacatagaatttgagcagaggatcttcaacaaaaacttaatg
cctcctatttcccagagtcccaaggagttttctatagatactgttgtgtacacagaagtt
atgatatga

DBGET integrated database retrieval system