KEGG   Rattus norvegicus (rat): 25111Help
Entry
25111             CDS       T01003                                 

Gene name
Chrm4, M4
Definition
(RefSeq) cholinergic receptor, muscarinic 4
  KO
K04132  muscarinic acetylcholine receptor M4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04725  Cholinergic synapse
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25111 (Chrm4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25111 (Chrm4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    25111 (Chrm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25111 (Chrm4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    25111 (Chrm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 25111
NCBI-ProteinID: NP_113735
RGD: 2344
Ensembl: ENSRNOG00000017556
UniProt: P08485 G3V894
Position
3q24
AA seq 478 aa AA seqDB search
MANFTPVNGSSANQSVRLVTAAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM
NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT
LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVPDKDTSNESSSGSA
TQNTKERPPTELSTAEATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVP
ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL
VNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggccaacttcacgcctgtcaatggcagctcagccaatcagtctgtgcgcctggtcaca
gcagcccacaaccacctggagacagtggagatggtgttcattgctacagtgactggctcc
ctgagcctggtgactgttgtgggtaacatcctggtgatgctgtccatcaaggtcaacagg
cagttgcagacggtcaacaactacttcctcttcagcctggcgtgtgcggatctcatcata
ggggcattctctatgaacctctacactttgtatatcatcaagggctactggcccctgggt
gccgtggtctgtgacttgtggctggccctggactatgtggtgagcaatgcctctgtcatg
aaccttcttatcatcagcttcgatcgttacttctgcgtcaccaaacccctcacctatccc
gcccgccgcactactaagatggcaggtctcatgatcgcagctgcctgggtcttgtccttt
gtgctctgggctcctgccatcttgttctggcagtttgtggtgggcaagaggacggtgcct
gataaccagtgcttcatccagttcttgtccaacccggcagtgacctttggcaccgccatt
gctgccttctacctgcctgtggtcatcatgacggtactgtatattcacatctcactggcc
agccgcagccgcgttcacaagcatcgacctgagggccccaaggagaagaaggccaagact
ctggctttcctcaagagccctctgatgaagccgagtatcaagaaacctccaccagggggc
gcttctcgagaggaactgcgcaatgggaagctggaagaggctcctccgccagccctgccc
ccgcctccacgcccagtgcctgacaaggacacttccaatgagtccagctcaggcagtgcc
acccagaacaccaaggaacggccacccacagagctgtccaccgcagaggccaccactcca
gcgctgcctgcccctaccctgcagccacgaaccctcaacccagcctccaaatggtccaag
attcaaattgtaacaaagcagacaggcaatgaatgtgtgacggccatcgagattgtacct
gccactccagctggtatgcgcccagcagccaatgtggcccgaaagtttgccagcattgct
cgcaaccaggtgcgcaagaagcggcagatggcggcccgggagcgcaaagtgactcggaca
atctttgccattctgctggccttcatcctcacctggacaccctacaatgtcatggtcctg
gtgaacaccttttgccagagctgtatccccgagagggtgtggtccatcggctactggctc
tgctacgtcaacagcaccatcaaccccgcctgctatgcactctgcaatgccactttcaaa
aagaccttccggcaccttttgctgtgccagtatcggaacatcggcacagccaggtag

DBGET integrated database retrieval system