KEGG   Rattus norvegicus (rat): 25114Help
Entry
25114             CDS       T01003                                 

Gene name
Fgfr4
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25114 (Fgfr4)
   04015 Rap1 signaling pathway
    25114 (Fgfr4)
   04010 MAPK signaling pathway
    25114 (Fgfr4)
   04151 PI3K-Akt signaling pathway
    25114 (Fgfr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25114 (Fgfr4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25114 (Fgfr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25114 (Fgfr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25114 (Fgfr4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25114 (Fgfr4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25114 (Fgfr4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25114 (Fgfr4)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   25114 (Fgfr4)
CD molecules [BR:rno04090]
 Proteins
  25114 (Fgfr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set ig Ig_2 V-set Ig_5 Kinase-like C2-set_2
Motif
Other DBs
NCBI-GeneID: 25114
NCBI-ProteinID: NP_001103374
RGD: 2612
Ensembl: ENSRNOG00000016763
UniProt: Q498D6
Position
17p14
AA seq 800 aa AA seqDB search
MWLLLALLSIFQETPAFSLEASEEMEQEPCPAPISEQQEQVLTVALGQPVRLCCGRTERG
RHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLIMDDSLPS
INNEDPKTLSSSSSGHSYLQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIHW
LKNGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLER
SPHRPILQAGLPANTTAVVGSNVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQV
LKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPAEEEDLAWTTAT
SEARYTDIILYVSGSLALVLLLLLAGVYHRQAIHGHHSRQPVTVQKLSRFPLARQFSLES
RSSGKSSLSLVRGVRLSSSGPPLLTGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVV
RAEALGMDSSRPDQTSTVAVKMLKDNASDKDLADLISEMEMMKLIGRHKNIINLLGVCTQ
EGPLYVIVEYAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQY
LESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALF
DRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLM
RECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPNNGDASSTCSSSDSVF
SHDPLPLEPSPFPFPEAQTT
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctgttggctttgttgagcatctttcaggagacaccagccttctcccttgag
gcctctgaggaaatggaacaggagccctgcccagccccaatctcggagcagcaagagcag
gtgttgactgtggcccttgggcagcctgtgcggctatgctgtggccgcactgagcgtggt
cgtcattggtacaaggagggcagccgtttagcatctgctgggagagtacggggctggaga
ggccgcctggagatcgccagcttccttcctgaggatgctggccggtacctctgcctggcc
cgtggctccatgactgtcgtacacaatcttactttgattatggatgactccttaccctcc
atcaataacgaggaccccaagaccctcagcagctcctcgagtgggcactcctacctgcag
caagcaccttactggacacacccccaacgcatggagaagaaactgcacgcggtacctgcc
gggaacactgtcaaattccgctgtccagctgcagggaaccccatgcccaccatccactgg
ctcaagaacggacaggccttccacggagagaatcgtatcggaggcattcggctgcgtcac
caacactggagcctcgtgatggagagcgtggtgccctcagaccgtggcacgtacacgtgt
cttgtggagaactctctgggtagcattcgctacagctatctgctggatgtgctggagcgg
tccccgcaccggcccatcctgcaggcgggactcccagccaacaccacggctgtggttggc
agcaacgtggagctgctgtgcaaggtgtacagtgacgcccagccgcacatccagtggctg
aagcacatcgttatcaacggcagcagtttcggcgctgatggtttcccctacgtacaagtc
ctgaagacaacagacatcaatagctcagaggtggaggtgctgtatctgaggaacgtgtcg
gctgaggatgcaggggagtacacctgcctggcgggcaactccatcggcctctcctaccag
tcagcgtggctcacagtgctacccgcagaggaagaagacctcgcgtggacaacagcaaca
tcggaggccagatatacagatattatcctatatgtatctggctcactggctttggttttg
ctcctgctgctggccggggtgtatcaccgacaagcaatccacggccaccactctcgacag
cctgtcactgtacagaagctgtcccggttccctttggcccggcagttctccttggagtcg
aggtcctctggcaagtcaagtttgtccctggtgcgaggtgtccggctctcctccagtggc
ccgcccttgctcacgggccttgtgagtctagacctacctctcgatccactttgggagttc
ccccgggacaggctggtgctcggaaagcccctgggtgagggctgctttgggcaagtggtt
cgtgcagaagcccttggcatggattcctcccggccagaccaaaccagcaccgtggctgtg
aagatgctgaaagacaatgcctccgacaaggatttggcagacctgatctctgagatggag
atgatgaagctaatcggaagacacaagaacatcattaacctgctgggtgtctgcactcag
gaagggcccctgtatgtgattgtggaatatgcggccaagggaaaccttcgggaattcctc
cgtgcccggcgtcccccaggccctgatctcagccctgatgggcctcggagcagcgaagga
ccgctctccttcccggccctggtctcctgtgcctaccaggtggcccgaggcatgcagtat
ctggagtctcggaagtgcatccaccgggacctggctgcccgaaacgtgctggtgaccgag
gatgacgtgatgaagatcgctgactttggtctggcccgtggtgtccaccacatcgactac
tataagaaaaccagcaatggccgcctgccagtcaagtggatggctcctgaggcgttgttt
gaccgtgtatacacacaccagagtgacgtgtggtccttcgggatcctgctgtgggaaatc
ttcaccctcgggggctccccataccccggcatcccagtggaggagctgttctcactgctg
cgagaggggcacaggatggagcggcccccaaactgcccctcagagctgtatgggctaatg
agggagtgttggcacgcagctccttctcagaggccgacttttaagcagctggtggaagct
ctggacaaggtcctgctggctgtctctgaagagtaccttgacctccgcctgacctttgga
ccctattcccccaacaatggggatgccagcagcacgtgctcctccagcgactcggttttc
agccacgaccctttgcccctcgagccaagccccttcccatttcctgaggcgcagaccaca
tga

DBGET integrated database retrieval system