KEGG   Rattus norvegicus (rat): 25116Help
Entry
25116             CDS       T01003                                 

Gene name
Hsd11b1, LRRGT00065
Definition
(RefSeq) hydroxysteroid 11-beta dehydrogenase 1
  KO
K15680  corticosteroid 11-beta-dehydrogenase isozyme 1 [EC:1.1.1.146]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00980  Metabolism of xenobiotics by cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Module
rno_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    25116 (Hsd11b1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25116 (Hsd11b1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    25116 (Hsd11b1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.146  11beta-hydroxysteroid dehydrogenase
     25116 (Hsd11b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C FMO-like Pyr_redox_2 2-Hacid_dh_C AdoHcyase_NAD Shikimate_DH Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 25116
NCBI-ProteinID: NP_058776
RGD: 2834
Ensembl: ENSRNOG00000005861
UniProt: P16232
Position
13q27
AA seq 288 aa AA seqDB search
MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLT
ARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQT
TMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYS
ASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALE
IIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacctcctccccgtcctggtgctctgcctgggttactactattctacaaat
gaagagttcagaccagaaatgctccaggggaagaaagtgattgtcactggggccagcaaa
gggatcggaagagaaatggcatatcatctgtcaaaaatgggagcccatgtggtattgact
gcaaggtcggaggaagggctccagaaggtggtgtctcgctgccttgaactcggagcagcc
tctgctcactatattgccggcactatggaagacatggcttttgcagagcgatttgttgtt
gaggcaggaaagctcttgggtggactggacatgctcattctcaatcacatcacacagacc
actatgtctctcttccacgatgatatccactctgtgcgaagaagcatggaggtcaacttc
ctcagctatgtggtcctgagcacagcagccttgcccatgctgaaacagagcaatggcagc
attgccatcatctcctccatggctgggaaaatgacccaacctctgattgcttcctactct
gcaagcaagtttgctctggatgggttcttttccaccattagaaaagaacacttgatgacc
aaggtcaacgtgtccatcactctctgtgtcctcggcttcatagacacagaaacagctttg
aaagaaacctctgggataatcttgagtcaagctgctcccaaggaggaatgcgccctggag
atcatcaaaggcacagttctgcgcaaagatgaggtatactatgacaaatcatcttggact
ccacttctgcttgggaatccaggaaggaggatcatggaatttctttcattacggtcatat
aacagggacctatttgtaagcaactag

DBGET integrated database retrieval system