KEGG   Rattus norvegicus (rat): 25117Help
Entry
25117             CDS       T01003                                 

Gene name
Hsd11b2
Definition
(RefSeq) hydroxysteroid 11-beta dehydrogenase 2
  KO
K00071  corticosteroid 11-beta-dehydrogenase isozyme 2 [EC:1.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04960  Aldosterone-regulated sodium reabsorption
Module
rno_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    25117 (Hsd11b2)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25117 (Hsd11b2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     25117 (Hsd11b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Motif
Other DBs
NCBI-GeneID: 25117
NCBI-ProteinID: NP_058777
RGD: 2835
Ensembl: ENSRNOG00000017084
Vega: OTTRNOG00000002200
UniProt: P50233
Position
19q12
AA seq 400 aa AA seqDB search
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVV
LAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNGPG
ALELRARCSPRLKLLQMDLTKPEDISRVLEITKAHTASTGLWGLVNNAGLNMVVADVELS
PVVTFRECMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIA
LLMDTFSCELLPWGIKVSIIQPGCFKTEAVTNVNLWEKRKQLLLANLPRELLQAYGEDYI
EHLHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYTGRGLGLMYFIHHYLPGGLRR
RFLQNFFISHLLPRALRPGQPGPVHDTTQDPNPSPTVSAL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctggccttggccgtcgggcggcgcctggctgctggtggctgcccgcgcgctg
ctgcagctgctgcgctcagacctgcgtctgggccgcccgttgttggcggcgctggccctg
ctggccgctctcgactggctgtgccagcgcctgctgcccccgccggctgcactcgtggtg
ctggctggtgctggctggatcgcgttgtcccgcctagcgcgccctcctcgcctgccggtg
gccactcgcgcggtgctcatcaccggttgtgacactggttttggcaaggagacagctaag
aaactggatgccatgggcttcacggtgctggccactgtgttggatttgaatggccctggt
gctctagaactgcgtgcccgatgttcccctcgcctgaagctgctgcagatggacctgacc
aagccagaggatatcagccgtgttctggaaattaccaaggctcacacggccagcactggc
ctgtggggtctggttaacaatgctggcctcaacatggtagtggccgatgtggaactgtct
ccagtggtaactttccgcgaatgtatggaggtgaacttctttggtgcacttgagctgacc
aagggcctcctgccactcctacgtcactcaaggggacgtattgtgaccgttggcagccca
gcaggagacatgccatacccctgcttggcagcctatggaacctccaaggcagctattgca
ctgctcatggacacattcagctgtgaactgcttccctggggtatcaaggtcagcatcatc
cagcctggctgcttcaagacagaggcagtgactaatgtgaacctctgggagaagcgcaag
caactgctgctggccaacttgcctagagagctgctgcaggcctatggtgaagactacatt
gagcacttgcatgggcaattcctgaattcactcagaatggcattgcctgaccttagcccc
gttgtagatgccatcattgatgcactgctggcagctcagccacgcagccgctactacacg
ggccgtggcctggggctcatgtatttcatccaccactacctgccaggaggcctgcggcgc
cgcttcctacagaacttcttcatcagtcaccttctaccccgagcactgaggcctggccaa
cctggccctgttcatgacacaacccaggacccaaacccttcccccacagtatcagctctg
tga

DBGET integrated database retrieval system