KEGG   Rattus norvegicus (rat): 25119
Entry
25119             CDS       T01003                                 

Gene name
Mr1, Hlals
Definition
(RefSeq) major histocompatibility complex, class I-related
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 Ig_2
Other DBs
NCBI-GeneID: 25119
NCBI-ProteinID: NP_001094105
RGD: 1593291
Ensembl: ENSRNOG00000003522
UniProt: O19477
Position
13q21
AA seq 343 aa
MMFLLPFLTVFLAKQSHTRTHSLRYFRLAISDPGPGVPEFISVGYVDSHPITTYDSVTRQ
KEPRAPWMAENLAPDHWERYTQLLRGWQRTFQTELRHLQRHYNHSGLHTYQRMIGCELLE
DGSTTGFLQYAYDGQDFIVFDKDTLSWLAMDNVAHITKRAWEANLHELQYQKNWLEEECI
AWLKRFLEYGSDALERTEHPVVRTTRKETFPGITTLFCRAHGFYPPEISMIWKKNGEEIV
QEVDYGGVLPSGDGTYQMWVSVDLDPQTKDIYSCHVEHCGLQMVLEAPQESGNTLLVANT
ISGTIILIIVLAGVGALIWRRRSREPKEVMYQPTQVNEGSSPS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgatgttcctgctaccgttcctcacagtatttttggcgaagcaaagccatacccggacc
cactctctgagatactttcgtctggctatttcggatcctggccctggagtccctgaattt
atctcagttgggtatgtggactcacaccctatcactacatacgacagcgtcacccgacag
aaggagccaagagccccatggatggcggagaacctggcgcctgaccactgggagaggtac
actcagctgctaagaggctggcagcggaccttccagacagagctgaggcacctgcagagg
cactacaaccactcagggcttcacacctaccagagaatgatcggttgtgagttgctggaa
gacggcagcaccacagggtttctccagtatgcatatgatggacaagatttcattgtcttc
gataaagacaccctctcctggctggctatggataatgtggctcacatcaccaagcgagca
tgggaggccaacctgcatgagttgcaataccaaaagaactggctagaagaagagtgcatt
gcctggctaaagaggttcttggagtatggaagtgatgccctagaaagaacagaacatcca
gtagtaagaacaactcgaaaggaaacgtttccagggattaccactctcttctgcagagct
catggcttctacccaccagaaatttccatgatatggaagaaaaatggggaagaaattgtc
caggaggtggattatggaggggtgcttcccagtggggatggaacctatcaaatgtgggtg
tcggttgatctggatcctcagaccaaagacatttattcttgtcatgtggagcactgtggt
ctccaaatggttctggaggcccctcaggaatcaggaaacacccttctagtggcaaacacg
atctctgggaccataattctcatcattgtcctggctggagttggtgccctgatctggaga
agaaggtcacgagaaccaaaagaagtcatgtaccaacccacccaagtcaatgagggcagc
tctccctcttag

DBGET integrated database retrieval system