KEGG   Rattus norvegicus (rat): 25122
Entry
25122             CDS       T01003                                 

Gene name
Scnn1a, ENaCA
Definition
(RefSeq) sodium channel epithelial 1 alpha subunit
  KO
K04824  amiloride-sensitive sodium channel subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
rno04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25122 (Scnn1a)
  09157 Sensory system
   04742 Taste transduction
    25122 (Scnn1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25122 (Scnn1a)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   25122 (Scnn1a)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 25122
NCBI-ProteinID: NP_113736
RGD: 3639
Ensembl: ENSRNOG00000019368
UniProt: P37089 Q6IRJ1
Position
4q42
AA seq 699 aa
MMLDHTRAPELNIDLDLHASNSPKGSMKGNQFKEQDPCPPQPMQGLGKGDKREEQGLGPE
PSAPRQPTEEEEALIEFHRSYRELFQFFCNNTTIHGAIRLVCSKHNRMKTAFWAVLWLCT
FGMMYWQFALLFEEYLSYPVSLNINLNSDKLVFPAVTVCTLNPYRYTEIKEELEELDRIT
EQTLFDLYKYNSSYTRQAGARRRSSRDLLGAFPHPLQRLRTPPPPYSGRTARSGSSSVRD
NNPQVDRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLSDTSPALEE
EALGNFIFTCRFNQAPCNQANYSKFHHPMYGNCYTFNDKNNSNLWMSSMPGVNNGLSLTL
RTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKEALDSLGGNYG
DCTENGSDVPVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPKPKGVEFCDYRKQSS
WGYCYYKLQGAFSLDSLGCFSKCRKPCSVINYKLSAGYSRWPSVKSQDWIFEMLSLQNNY
TINNKRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAEL
IFDLLVITLLMLLRRFRSRYWSPGRGARGAREVASTPASSFPSRFCPHPTSPPPSLPQQG
MTPPLALTAPPPAYATLGPSAPPLDSAAPDCSACALAAL
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgatgctggaccacaccagagcccctgagctcaacattgacctagaccttcacgcctcc
aactcgcctaaggggtccatgaagggcaaccaattcaaggagcaagacccttgtcctcct
cagcccatgcaaggactggggaagggggacaaacgtgaagagcagggcctgggcccggaa
ccctcagcaccccggcagcccaccgaggaggaggaggcactgattgagttccaccgctcc
taccgggagctcttccagttcttctgcaacaacaccaccatccacggggccatccgcctg
gtgtgctccaaacacaaccgcatgaagacggccttctgggcggtgctgtggctgtgcacc
ttcggcatgatgtactggcagttcgccttgctgttcgaggagtacctcagctacccagtg
agcctcaacatcaacctcaattcagacaagctggtcttccctgccgtcactgtctgcacc
cttaatccttacagatacactgaaattaaagaggagctggaagagctggaccgcatcacg
gagcagacgctttttgacttgtacaaatacaactcttcctacactcgccaggctggggcc
cgacgccgcagctcccgcgacctcctgggtgctttcccgcaccccctgcagcgcctgcgc
actccacctccgccctactccggccgcacggcgcgcagcgggtcttccagcgtacgcgac
aacaatccccaagtggaccggaaggactggaagatcggcttccaactgtgcaaccagaac
aaatcagactgtttctaccagacatactcctctggggtggatgcagtgagggagtggtac
cgcttccattacatcaacattctgtccaggctgtcggacacctcgcccgctctagaggaa
gaagccctgggcaacttcatcttcacctgtcgcttcaaccaggccccctgcaaccaggcg
aattattccaagttccaccaccccatgtacgggaactgctacactttcaatgacaagaac
aactccaatctctggatgtcctccatgcctggagtcaacaatggtttgtccctgacactg
cgcacagagcagaatgacttcatccccctgctgtccacagtgacgggggccagggtgatg
gtgcatggtcaggatgagcctgcctttatggatgatggtggcttcaacttgaggcctggc
gtggagacctccatcagtatgagaaaggaagccctggacagcctcggaggaaattacggc
gactgtactgagaatggtagcgatgtcccggtcaagaacctttacccttccaagtataca
cagcaggtgtgcattcactcctgcttccaggagaacatgatcaagaagtgtggctgtgcc
tacatcttctaccctaagcccaagggagttgagttctgtgactaccgaaagcagagctcc
tggggctattgctattataaactgcagggcgccttctccttggacagcctgggctgtttc
tccaagtgtcggaagccttgtagtgtgatcaactacaaactctctgccggctactcacgg
tggccatctgtgaagtcccaggattggatcttcgagatgctgtccttgcagaacaattac
actattaacaacaaaagaaacggagttgcaaagctcaacatcttcttcaaggagctgaac
tataaaactaattcggagtctccttctgtcacgatggtcagcctcctgtccaacctgggc
agccagtggagcctgtggtttggctcgtccgtgctctctgtggtggagatggcggagctc
atcttcgacctcctggtcatcacacttctcatgctgctacgccggttccggagccggtac
tggtctccaggacgaggggccaggggtgccagggaggtggcctccactccagcttcctcc
ttcccgtcccgtttctgtcctcaccctacatccccaccaccttctttgccccagcagggc
atgacccctcccctggccctgacagcccctccacctgcctatgctactctaggccccagt
gcccctccactggactctgcggcgcctgactgttctgcctgtgccctggcggcgctctga

DBGET integrated database retrieval system