KEGG   Rattus norvegicus (rat): 25124Help
Entry
25124             CDS       T01003                                 

Gene name
Stat1, DD6G4-4
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  Jak-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05212  Pancreatic cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    25124 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25124 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25124 (Stat1)
   04621 NOD-like receptor signaling pathway
    25124 (Stat1)
   04625 C-type lectin receptor signaling pathway
    25124 (Stat1)
   04658 Th1 and Th2 cell differentiation
    25124 (Stat1)
   04659 Th17 cell differentiation
    25124 (Stat1)
   04062 Chemokine signaling pathway
    25124 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    25124 (Stat1)
   04919 Thyroid hormone signaling pathway
    25124 (Stat1)
  09158 Development
   04380 Osteoclast differentiation
    25124 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25124 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25124 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    25124 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    25124 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25124 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25124 (Stat1)
  09172 Infectious disease: viral
   05162 Measles
    25124 (Stat1)
   05164 Influenza A
    25124 (Stat1)
   05161 Hepatitis B
    25124 (Stat1)
   05160 Hepatitis C
    25124 (Stat1)
   05168 Herpes simplex virus 1 infection
    25124 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25124 (Stat1)
   05169 Epstein-Barr virus infection
    25124 (Stat1)
   05165 Human papillomavirus infection
    25124 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25124 (Stat1)
   05140 Leishmaniasis
    25124 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25124 (Stat1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    25124 (Stat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 TRPM_tetra BLI1
Motif
Other DBs
NCBI-GeneID: 25124
NCBI-ProteinID: NP_001029336
RGD: 3771
Ensembl: ENSRNOG00000014079
UniProt: Q6P6Q7
Position
9q22
AA seq 712 aa AA seqDB search
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIHNCLKEERKILENAQ
RFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEHEIKTLEDLQDEYDFKCKTSQNR
ESEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAESLQQVRQQLKKLEELEQKFTYEQDPITKNKQV
LSDRTFVLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEV
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtggtacgagcttcagcagctggactccaagttcctggagcaggtgcaccag
ctgtacgatgacagtttccccatggaaatcagacagtacctggcccagtggctagaaaag
caagactgggagcatgctgcctacgacgtctcgttcgccaccatccgcttccatgacctg
ctctcccagctggatgaccagtacagccgcttttctttggagaataatttcttgttgcag
cacaacataaggaaaagcaagcgtaatctccaggataacttccaagaagatcccgtacag
atgtccatgatcatccacaactgtctgaaggaggagaggaagattttggaaaacgcccag
cgatttaatcaggcccaggagggaaatattcagaacaccgtgatgttagataaacagaag
gagctggacagtaaagtcagaaatgtgaaggaccaagtcatgtgcatagagcatgaaatc
aagaccctagaagacttacaagatgaatatgactttaaatgcaaaacctctcagaacaga
gaaagcgaagccaatggtgtggcgaagagcgaccagaaacaggaacagctgctgctgcat
aagatgttcttaatgcttgacaacaagagaaaggagataattcacaaaatcagagagctg
ctgaactccatcgagctcactcagaacactctgattaatgatgagcttgtggagtggaag
cgaagacagcagagtgcctgcattgggggaccgcccaatgcctgcctggatcagctgcaa
agctggttcaccattgttgcagagagcctgcagcaggtccgtcagcagcttaaaaagctg
gaggagttggaacagaaattcacctatgagcaggaccctattacaaaaaacaagcaggtg
ttatccgatcgcaccttcgtcctcttccagcagctcattcagagctcctttgtggtggaa
cgacagccgtgcatgccaactcaccctcagaggcccctggtcttgaagactggggtacag
ttcactgtgaagctgagactgttggtgaaattgcaagaactgaactataacttgaaagtg
aaagtctcatttgacaaagatgtgaacgagaaaaacacagtgaaaggattccggaagttc
aacatcttgggtactcacacaaaagtgatgaacatggaagaatccaccaacggaagtttg
gcagctgagttccgacacctgcaactgaaggaacagaaaaatgctgggaacagaaccaat
gagggtcctctcattgtcaccgaagaacttcactctcttagctttgaaacccagttgtgc
cagccaggcttggtgattgaccttgagaccacctctcttcccgtcgtggtgatctccaat
gtcagccagctccccagtggctgggcttctatcctgtggtacaacatgctggtgacagag
cccaggaatctctccttcttcctgaaccccccgtgtgcgtggtggtcccagctctcagag
gtgctgagttggcagttttcgtcagtcaccaagagaggtctcaacgctgaccagctgagc
atgctgggggagaagcttctgggccctaatgctggccctgatggtcttattccatggaca
aggttctgtaaggaaaatattaacgataagaatttctccttctggccttggattgacacc
atcctagaactcattaagaagcacctgctttgcctctggaatgatgggtgcatcatgggc
tttatcagcaaggagcgagaacgtgctctgctcaaggaccagcagcccgggacgttcctg
cttaggttcagtgagagctcccgggaaggggccatcacattcacatgggtggaacggtcc
caaaatggaggtgaacccgacttccatgctgttgagccctacacgaagaaagaactttca
gctgttactttcccagatattattcgcaattacaaagtcatggctgctgagaatatacca
gagaatcccctgaagtatctgtatcccaatattgacaaagaccatgccttcgggaagtac
tactccaggccaaaggaagcaccagaaccgatggagctcgatgaccctaagagaactgga
tacatcaagactgagttgatttctgtgtctgaagtgtaa

DBGET integrated database retrieval system