KEGG   Rattus norvegicus (rat): 25124
Entry
25124             CDS       T01003                                 

Gene name
Stat1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta isoform beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05212  Pancreatic cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    25124 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25124 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25124 (Stat1)
   04621 NOD-like receptor signaling pathway
    25124 (Stat1)
   04625 C-type lectin receptor signaling pathway
    25124 (Stat1)
   04658 Th1 and Th2 cell differentiation
    25124 (Stat1)
   04659 Th17 cell differentiation
    25124 (Stat1)
   04062 Chemokine signaling pathway
    25124 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    25124 (Stat1)
   04935 Growth hormone synthesis, secretion and action
    25124 (Stat1)
   04919 Thyroid hormone signaling pathway
    25124 (Stat1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25124 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25124 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25124 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    25124 (Stat1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    25124 (Stat1)
   05160 Hepatitis C
    25124 (Stat1)
   05171 Coronavirus disease - COVID-19
    25124 (Stat1)
   05164 Influenza A
    25124 (Stat1)
   05162 Measles
    25124 (Stat1)
   05168 Herpes simplex virus 1 infection
    25124 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25124 (Stat1)
   05169 Epstein-Barr virus infection
    25124 (Stat1)
   05165 Human papillomavirus infection
    25124 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    25124 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25124 (Stat1)
   05140 Leishmaniasis
    25124 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    25124 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25124 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25124 (Stat1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    25124 (Stat1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 TRPM_tetra BLI1
Other DBs
NCBI-GeneID: 25124
NCBI-ProteinID: NP_001029336
RGD: 3771
Ensembl: ENSRNOG00000014079
UniProt: Q6P6Q7
Position
9
AA seq 712 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIHNCLKEERKILENAQ
RFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEHEIKTLEDLQDEYDFKCKTSQNR
ESEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAESLQQVRQQLKKLEELEQKFTYEQDPITKNKQV
LSDRTFVLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEV
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgtcgcagtggtacgagcttcagcagctggactccaagttcctggagcaggtgcaccag
ctgtacgatgacagtttccccatggaaatcagacagtacctggcccagtggctagaaaag
caagactgggagcatgctgcctacgacgtctcgttcgccaccatccgcttccatgacctg
ctctcccagctggatgaccagtacagccgcttttctttggagaataatttcttgttgcag
cacaacataaggaaaagcaagcgtaatctccaggataacttccaagaagatcccgtacag
atgtccatgatcatccacaactgtctgaaggaggagaggaagattttggaaaacgcccag
cgatttaatcaggcccaggagggaaatattcagaacaccgtgatgttagataaacagaag
gagctggacagtaaagtcagaaatgtgaaggaccaagtcatgtgcatagagcatgaaatc
aagaccctagaagacttacaagatgaatatgactttaaatgcaaaacctctcagaacaga
gaaagcgaagccaatggtgtggcgaagagcgaccagaaacaggaacagctgctgctgcat
aagatgttcttaatgcttgacaacaagagaaaggagataattcacaaaatcagagagctg
ctgaactccatcgagctcactcagaacactctgattaatgatgagcttgtggagtggaag
cgaagacagcagagtgcctgcattgggggaccgcccaatgcctgcctggatcagctgcaa
agctggttcaccattgttgcagagagcctgcagcaggtccgtcagcagcttaaaaagctg
gaggagttggaacagaaattcacctatgagcaggaccctattacaaaaaacaagcaggtg
ttatccgatcgcaccttcgtcctcttccagcagctcattcagagctcctttgtggtggaa
cgacagccgtgcatgccaactcaccctcagaggcccctggtcttgaagactggggtacag
ttcactgtgaagctgagactgttggtgaaattgcaagaactgaactataacttgaaagtg
aaagtctcatttgacaaagatgtgaacgagaaaaacacagtgaaaggattccggaagttc
aacatcttgggtactcacacaaaagtgatgaacatggaagaatccaccaacggaagtttg
gcagctgagttccgacacctgcaactgaaggaacagaaaaatgctgggaacagaaccaat
gagggtcctctcattgtcaccgaagaacttcactctcttagctttgaaacccagttgtgc
cagccaggcttggtgattgaccttgagaccacctctcttcccgtcgtggtgatctccaat
gtcagccagctccccagtggctgggcttctatcctgtggtacaacatgctggtgacagag
cccaggaatctctccttcttcctgaaccccccgtgtgcgtggtggtcccagctctcagag
gtgctgagttggcagttttcgtcagtcaccaagagaggtctcaacgctgaccagctgagc
atgctgggggagaagcttctgggccctaatgctggccctgatggtcttattccatggaca
aggttctgtaaggaaaatattaacgataagaatttctccttctggccttggattgacacc
atcctagaactcattaagaagcacctgctttgcctctggaatgatgggtgcatcatgggc
tttatcagcaaggagcgagaacgtgctctgctcaaggaccagcagcccgggacgttcctg
cttaggttcagtgagagctcccgggaaggggccatcacattcacatgggtggaacggtcc
caaaatggaggtgaacccgacttccatgctgttgagccctacacgaagaaagaactttca
gctgttactttcccagatattattcgcaattacaaagtcatggctgctgagaatatacca
gagaatcccctgaagtatctgtatcccaatattgacaaagaccatgccttcgggaagtac
tactccaggccaaaggaagcaccagaaccgatggagctcgatgaccctaagagaactgga
tacatcaagactgagttgatttctgtgtctgaagtgtaa

KEGG   Rattus norvegicus (rat): 288774
Entry
288774            CDS       T01003                                 

Gene name
Stat2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    288774 (Stat2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    288774 (Stat2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    288774 (Stat2)
   04625 C-type lectin receptor signaling pathway
    288774 (Stat2)
   04062 Chemokine signaling pathway
    288774 (Stat2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    288774 (Stat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    288774 (Stat2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    288774 (Stat2)
   05160 Hepatitis C
    288774 (Stat2)
   05171 Coronavirus disease - COVID-19
    288774 (Stat2)
   05164 Influenza A
    288774 (Stat2)
   05162 Measles
    288774 (Stat2)
   05168 Herpes simplex virus 1 infection
    288774 (Stat2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    288774 (Stat2)
   05169 Epstein-Barr virus infection
    288774 (Stat2)
   05165 Human papillomavirus infection
    288774 (Stat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    288774 (Stat2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    288774 (Stat2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2 PspA_IM30 IRF-2BP1_2
Other DBs
NCBI-GeneID: 288774
NCBI-ProteinID: NP_001011905
RGD: 1311649
Ensembl: ENSRNOG00000031081
UniProt: Q5XI26
Position
7
AA seq 842 aa
MAQWEMLQNLDSPFLDQLHELYSQSLLPMDVRQHLAAWIEDQNWREAVLGSDHSKANMLY
FNILDQLNQWDHYSLDSDYLLLQHNLRKFNRDIQMFPNGPTQLAEMIFNLLLEEKRILNQ
AQRAQEMQPRPAPEAAGESQQQLEIETRILDLQTAVEALVRSIRQLKDVQDVFSFRYTVL
NHKKTSSLDPHQSQQRQLVQTTANELDRMRKEVLDISKALVGRLTTLVDLLLPKLDEWKA
QQQKSCIGAPAPELQLDQLEQWLTAGAKVLFHLRQLLKQLKDMSLMLRYEGDMFGQGVDL
QNAQVTELLQRLLQRSFVVETQPCMPQTLHRPLILKTGSKFTVRTRLLVRLQEGNESLKA
EVSIDRNSELPGFRKFNILTSNQKSLTPEEGQRQGLIWDFGFLTLVEQRSVGAGKGSNKG
PLPVTEELHIISAMVEYVYQGLKMKLQTDTLPVVIISNMNQLSIAWASILWFNMLSSTPK
DQQFFCKVPKAPWSLLGPALSWQFSSYIGRGLDPEQLGMLRNKLFGKNCKTEDALLSWAD
FSKRESPPGKIPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSEERRLLKKMVSGTFLL
RFSETSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQVLAEENAPENP
LRFLYPRVPRDEAFGCYYQEKVNLEERRKYLKHRLIVISNRQADELQQPLELKQDPESLE
LDAELMSVMELARDLELQSMLQVGLDLGVEPKPDPTLSPAPQILLEPDPARALNQLLPEP
DLPQDLQQLNTGEMEIFRNNINIDDVMPYGDPVLAGQSIIEEAYRSCPSHFDVDGPLIPS
ED
NT seq 2529 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgttgcagaaccttgacagtccatttctggaccagttgcatgag
ctctactcacaaagcctcctgccaatggacgtccgacagcacttggctgcctggattgaa
gaccagaactggagggaagctgtactaggcagtgatcattccaaggccaacatgctatac
ttcaacatcctggaccagctgaaccagtgggaccactacagcttggactccgactacctt
ttattacagcataacttgcgaaaattcaatcgggacattcagatgtttcccaatggccct
acccagttggctgagatgatcttcaatcttctcctggaagagaaaaggattctgaatcag
gcccaaagagctcaagagatgcagcccaggccagcccctgaagcggcaggggagagccag
cagcagcttgagattgaaacaagaatcctggatttacagactgctgtggaggcgctggtg
agatccatcaggcagctgaaggatgtgcaggatgtcttcagcttcagatacacagttctc
aatcacaagaagacatcgtctttggacccccatcagagccaacagcggcagcttgtgcag
acaacagccaatgaactggacagaatgagaaaggaggtgctggacatctccaaagccctg
gttggacgattaaccaccctggtcgacctgttgctgccaaagctggatgagtggaaggct
cagcagcagaagtcctgcattggagccccagcacccgagctgcagctggatcagctggaa
cagtggttgacagctggagcaaaggtcttgttccaccttcggcagctactgaagcaactg
aaggatatgagtcttatgcttcgttatgagggtgacatgtttggccaaggggtggacctg
cagaatgcccaagtcacggagttacttcagcgtctgctccaaaggtcctttgtagtggaa
acccagccctgcatgccccagactctccatcgacccctcatcctgaagactgggagcaag
ttcactgtccgaacaagactgctggtgagactccaggaaggcaatgaatcactcaaagca
gaagtctccattgacaggaattcagagttgccaggcttccggaagttcaacattctgacc
tcaaaccagaagtccttgacccctgaggaaggccagagacaaggcttaatttgggacttc
ggcttcttgacgctggtggagcagcgctcagtgggcgcaggaaagggcagcaacaagggg
ccgctgcctgtgacagaggagctacacatcatcagcgccatggtggagtacgtttaccag
ggtctgaagatgaagctgcagacggacactctccctgtggtgattatctctaacatgaac
caactctccattgcctgggcctccattctctggttcaacatgctcagctcaactcccaag
gaccagcagttcttctgcaaagttccgaaagctccgtggagtttgctggggcctgcactc
agttggcagttctcctcctacatcggccgaggcctcgatcctgagcagctgggcatgctg
agaaacaagctgttcggaaagaactgcaagacagaggatgcactgttgtcctgggcagac
ttcagcaagcgagagagcccccctggcaagatccctttctggacctggctggacaaaatt
ctggagctggtacatgaccacctgaaggatctctggaatgatgggcgcatcatgggcttt
gtgagccggagcgaggaacgccgactactgaagaagatggtgtcgggcaccttcctgctg
cgcttcagtgagacttctgaagggggcattacctgctcttgggtggagcaccaggatgat
gataaagtcctcatctactctgtgcagccctacaccaaggaagtgctacagtcactccca
ctgacagaaatcatccgccactaccaggttctcgccgaagagaatgctcctgagaaccca
ctccgcttcctctatccccgcgtccctcgggacgaagcctttgggtgttactaccaggaa
aaagttaacttggaagaacggaggaaatacctgaaacatagactcatcgtgatctctaac
agacaggcggacgagctgcagcagcctctggagcttaaacaggatccagagtccttagag
ctggatgcagagctcatgtcagtgatggagttggcacgagacctggagctgcagtcaatg
ctgcaggtggggctggacctgggcgtagagccgaaaccagatcccacactgagtccagcc
ccacaaatcctgctggagccagacccagcacgtgcattgaatcagctgttgccagagccg
gatttgcctcaggacctgcagcagctgaacacaggggagatggaaatcttcagaaacaac
ataaatattgatgacgtcatgccctacggtgacccagtgttggctggccagagcatcata
gaggaggcttacaggtcctgccccagccattttgacgtggatggacccttgattccttct
gaagactaa

DBGET integrated database retrieval system