KEGG   Rattus norvegicus (rat): 25129Help
Entry
25129             CDS       T01003                                 

Gene name
Egr4, Egr4l1, NGFI-C
Definition
(RefSeq) early growth response 4
  KO
K12498  early growth response protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25129 (Egr4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    25129 (Egr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_8 DUF3446
Motif
Other DBs
NCBI-GeneID: 25129
NCBI-ProteinID: NP_062010
RGD: 2546
Ensembl: ENSRNOG00000015719
UniProt: Q00911
Position
4q34
AA seq 478 aa AA seqDB search
MLHLSDFSGPDALLSKPTEGCAHTSPELPRLPARDAPSAAAYPGGDFLSWALSTCGAGGD
LTDSCFLEGPAPTPPSGLSYSGSFFIQAVPEHPHDPEALFNLMSGILGLAPFPSPEAAAS
RSPLDVPFPAGPDALLPDLYSPDLSSAAFPEAFWEAAPSAGAPSQCLFEPQLSPPDVKPG
LRAPPASPALDAAASAFKGPYAPWELLSAGAPGNCGSQGSFQTTPEARFSAVGTKVEDLL
SISCPAELPGPASRLYPPGAYDAFSLAPGDLGEGTEGLPALLTPPGGEGGSGGEGGEFLA
VPQAQLSPLGLRGAATADFSKALVADLPGGSGVAAPSSPATSFPAAKARRKGRRGGKCSA
RCFCPRPHVKAFACPVESCVRTFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTH
VRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFAAL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctccacctgagcgacttctccggccccgacgcgctcctctccaagcccaccgaaggc
tgcgcccacaccagccccgagctgccccggctgcctgctagggacgctccctcggccgcc
gcgtatcctggaggcgacttcttgagctgggctctgagcacctgcggcgccgggggggac
ttaacagactcctgcttcctggagggccctgcacccacgcccccttcgggcctcagctac
agcggcagcttcttcatccaggcggttcccgaacacccgcacgacccggaggccctcttc
aacctcatgtctggcatcttgggcttggcacccttccctagccccgaggcggcagcgtct
cggtcccccctggatgtccctttccccgcgggtcccgatgccttgttgccggacctttac
tccccggatctgagttcggccgccttcccggaggcgttttgggaggccgcgccttcggcg
ggcgctccctcgcagtgcctgttcgagccccagctctccccgcccgacgtcaagcccggg
ctgagggcgcctcccgcttcgccagcgctggacgctgctgcttcggccttcaaagggccc
tacgccccctgggagctgctgtcggccggggctccggggaactgtgggtcgcagggaagc
ttccagaccaccccggaggcacgcttttccgccgtggggaccaaggtcgaggacctgctg
tccatcagctgccccgccgagctgcccggtccggctagcagactctacccgccaggggcc
tacgatgccttctcgctggccccaggtgacttaggggaggggaccgagggcctcccggcg
ctgctgacccctccgggcggggagggagggagcggcggcgaaggcggagagttcctggcc
gtccctcaagcgcagctgtccccgctgggcctgcgcggcgccgccacggcagacttctcc
aaagccctggtggccgacctcccggggggcagcggagtggcggcgccttcatcccccgcc
acctccttccccgcggccaaagcccggcgcaagggacgccggggcggcaagtgcagcgcg
cgctgcttctgcccgcggccgcacgtcaaggccttcgcctgccccgtggagagctgcgtg
cggacgttcgcgcgctccgacgagctcaaccgccacctgcgcatccacacgggccacaag
cccttccagtgccgcatctgcctgcgcaacttcagccgcagcgaccacctcaccacgcac
gtgcgcacccacaccggcgagaagcccttcgcctgcgacgtgtgcggccgccgcttcgcg
cgcagcgacgagaagaagcgacacagcaaggtgcacctcaagcagaaggcgcgcgccgag
gagcgcctcaagggcctgggcttctactcgctgggcctctctttcgccgcgctgtag

DBGET integrated database retrieval system