KEGG   Rattus norvegicus (rat): 25134Help
Entry
25134             CDS       T01003                                 

Gene name
Gnmt
Definition
(RefSeq) glycine N-methyltransferase
  KO
K00552  glycine N-methyltransferase [EC:2.1.1.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    25134 (Gnmt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.20  glycine N-methyltransferase
     25134 (Gnmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_11 Methyltransf_23 TehB Ubie_methyltran MTS NodS CMAS PCMT TPMT Methyltransf_15
Motif
Other DBs
NCBI-GeneID: 25134
NCBI-ProteinID: NP_058780
RGD: 2719
Ensembl: ENSRNOG00000016349
UniProt: P13255
Structure
PDB: 

Position
9q12
AA seq 293 aa AA seqDB search
MVDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHR
VLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLT
LDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDY
ILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFR
LSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggtggacagcgtgtaccgtacccgctccctgggggtggcggccgaagggatccccgac
cagtatgcggatggggaggccgcacgtgtgtggcagctgtacatcggggacacccgcagc
cgtactgcagagtacaaggcgtggttgcttgggctgctgcgccagcacgggtgccaccgg
gtgctggacgtggcctgtggcacaggagtggactcgattatgctggtggaagagggcttt
agcgtcacgagtgtggatgccagcgacaagatgctgaaatacgcactgaaggagcgctgg
aaccggaggaaggagccagcctttgacaagtgggtcattgaagaagccaactggttgact
ctggacaaagatgtgccagcaggagatggctttgacgctgtcatctgccttgggaacagt
tttgctcacctgccggacagcaaaggtgaccagagtgagcaccggctggcgctaaagaac
atcgcaagcatggtgcggcccgggggcctgctggtcatcgaccaccgcaactacgactac
atcctcagcacgggctgtgcacccccagggaagaacatctactataagagtgacctgacc
aaggacattacgacgtcagtgctgacagtaaacaacaaagcccacatggtaaccctggac
tacacagtgcaggtgccaggtgctggcagagatggcgctcctggcttcagtaagtttcgg
ctctcttactacccacactgtttggcgtctttcacggagttggtccaagaagcctttggg
ggcaggtgccagcacagcgtcctgggtgacttcaagccttacaggcccggccaggcctac
gttccctgctacttcatccacgtgctcaagaagacaggctga

DBGET integrated database retrieval system