KEGG   Rattus norvegicus (rat): 25135Help
Entry
25135             CDS       T01003                                 

Gene name
Ncl
Definition
(RefSeq) nucleolin
  KO
K11294  nucleolin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    25135 (Ncl)
   03036 Chromosome and associated proteins [BR:rno03036]
    25135 (Ncl)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    25135 (Ncl)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     25135 (Ncl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Treacle NOP5NT
Motif
Other DBs
NCBI-GeneID: 25135
NCBI-ProteinID: NP_036881
RGD: 3153
Ensembl: ENSRNOG00000018273
Vega: OTTRNOG00000001097
UniProt: Q5U328
Position
9q35
AA seq 714 aa AA seqDB search
MVKLAKAGKTHGESKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTP
AKKVVVSQTKKAAVPTPAKKAAVTPGKKAAATPAKKAVTPAKVVPTPGKKGAAQAKALVP
TPGKKGAVTPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDEEDEFEPPVVKGVKPAKA
APAAPASEDEDEEDDDDEEDDDDDDEEEEEEDDSEEEVMEITPAKGKKTPAKVVPVKAKS
VAEEEEDDEDDEDEEEDEDEEDEEDDEDEDEEEEEEPVKAAPGKRKKEMTKQKEAPEAKK
QKIEGSEPTTPFNLFIGNLNPNKSVAELKVAISELFAKNDLAAVDVRTGTNRKFGYVDFE
SAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFED
AVEIRLVSQDGRSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTG
KNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNPHGKSKGYAFIEFASFEDA
KEALNSCNKMEIEGRTIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFEGSV
RARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGR
GGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactcgcaaaggccggcaaaacccacggagagtccaagaaaatggctcctcct
ccaaaggaggtggaagaagatagtgaggatgaagaaatgtcagaagatgaagatgacagc
agtggagaagaggaggttgtcatccctcagaagaaaggcaaaaaggctaccacaactcca
gcaaagaaggtggttgtttcacaaacaaaaaaggctgcagttcccacaccagctaagaaa
gcagctgttaccccaggcaaaaaggcagcagccacaccagccaagaaagctgttacacca
gccaaagtagttccaacacctggtaaaaagggagctgcacaagcaaaagcattggtacca
actcctggtaaaaagggagctgtcactccagccaagggggctaagaatggtaagaatgcc
aagaaggaagacagcgatgaggatgaagatgaagaggatgaagatgacagcgatgaggat
gaagatgaagaggatgaatttgagccaccggtagtaaaaggagtgaaaccagcaaaagca
gctcctgctgctcctgcctcagaggatgaggatgaggaagatgatgatgatgaagaagat
gatgatgatgatgatgaagaggaggaggaggaagatgactctgaggaagaagttatggag
atcacaccagccaaaggaaagaaaactcctgcaaaagttgttcctgtgaaagccaagagt
gtggccgaggaggaggaagatgatgaggatgatgaagatgaagaggaggatgaagatgaa
gaagatgaagaggacgatgaagatgaggatgaggaagaagaggaagaacctgttaaagca
gcacctggaaaacggaagaaggagatgaccaagcagaaagaagcccctgaagccaagaaa
cagaaaatagaaggctcagaaccaactacacctttcaacctgttcattggaaaccttaat
ccaaacaagtctgttgctgaattaaaagttgccatcagtgaactttttgctaaaaatgat
cttgctgctgtggatgtcagaactggtacaaataggaaatttggttatgttgattttgag
tctgctgaagacctagaaaaggccctggagctcactggtttaaaagtgtttggcaatgaa
attaaactagaaaaaccaaaaggaagagatagtaagaaagttcgagctgcaagaacactt
ttagccaaaaacctctctttcaacatcactgaggatgaattaaaagaagtgtttgaagat
gctgtggagatcagattagtcagccaggatgggagaagtaaagggattgcttatattgaa
tttaagtctgaggctgatgcagagaaaaacttggaagaaaagcagggggcagaaattgat
ggacggtctgtttcactctactacactggagagaaaggacaaaggcaagagagaactgga
aagaatagcacttggagtggtgaatcaaagactttggttttaagtaacctttcctacagt
gcaacagaagaaacacttcaggaagtattcgagaaagcaacctttattaaagtgccccag
aacccacatggcaaatctaaagggtatgcatttatagaatttgcttcatttgaagatgct
aaagaagctttaaattcctgtaataaaatggaaattgagggcagaacaatcaggctggag
ttgcaaggacccaggggatcacctaatgcgagaagtcagccatccaaaactctgtttgtc
aaaggtctgtctgaggataccactgaagagaccttaaaagaatcatttgagggctctgtt
cgtgcaagaatagtaactgatcgggaaactggttcttctaaagggtttggttttgtagac
tttaatagtgaggaagatgccaaagctgccaaggaggccatggaagatggagaaattgat
ggaaacaaagttaccttggactgggccaaacctaagggtgaaggtggctttggtggtcga
ggtggaggcagaggaggtttcggaggcagaggtggtggcagaggcggaagaggcggattt
ggcggaagaggccggggaggctttggaggcagaggaggcttccgaggcggcagaggaggc
gggggagacttcaagccacaaggaaagaagacgaagtttgaatag

DBGET integrated database retrieval system