KEGG   Rattus norvegicus (rat): 25136
Entry
25136             CDS       T01003                                 

Gene name
Gfra2, Retl2
Definition
(RefSeq) GDNF family receptor alpha 2
  KO
K19895  GDNF family receptor alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25136 (Gfra2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  25136 (Gfra2)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 25136
NCBI-ProteinID: NP_036882
RGD: 61809
Ensembl: ENSRNOG00000014010
UniProt: O35977
Position
15p11
AA seq 464 aa
MILANAFCLFFFLDETLRSLASPSSLQGSELHGWRPQVDCVRANELCAAESNCSSRYRTL
RQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGE
EFYEASPYEPVTSRLSDIFRLASIFSGTGTDPAVSTKSNHCLDAAKACNLNDNCKKLRSS
YISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPS
CSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYRTITSCPADNYQACLGSYAGM
IGFDMTPNYVDSNPTGIVVSPWCNCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTD
VNMSPKGPSLPATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSIQEQGLKANNSKELSM
CFTELTTNISPGSKKVIKLNSGSSRARLSAALTALPLLMLTLAL
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatcttggcaaacgccttctgcctcttcttctttttagacgaaaccctccgctctttg
gccagcccttcctccctgcagggctctgagctccacggctggcgcccccaagtggactgt
gtccgggccaatgagctgtgtgcggctgaatccaactgcagctccaggtaccgcaccctt
cggcagtgcctggcaggccgggatcgcaataccatgctggccaataaggagtgccaggca
gccctggaggtcttgcaggaaagcccactgtatgactgccgctgcaagcggggcatgaag
aaggagctgcagtgtctgcagatctactggagcatccatctggggctgacagagggtgag
gagttctatgaagcttccccctatgagcctgtgacctcgcgcctctcggacatcttcagg
ctcgcttcaatcttctcagggacagggacagacccggcggtcagtaccaaaagcaaccac
tgcctggatgccgccaaggcctgcaacctgaatgacaactgcaagaagcttcgctcctct
tatatctccatctgcaaccgtgagatctctcccaccgaacgctgcaaccgccgcaagtgc
cacaaggctctgcgccagttctttgaccgtgtgcccagcgagtatacctaccgcatgctc
ttctgctcctgtcaggaccaggcatgtgctgagcgtcgccggcaaaccatcctgcccagt
tgctcctatgaggacaaggagaagcccaactgcctggacctgcgcagcctgtgtcgtaca
gaccacctgtgccggtcccgactggcagatttccacgccaactgtcgagcctcctaccgg
acaatcaccagctgtcctgcggacaactaccaggcatgtctgggctcctatgctggcatg
attgggtttgatatgacacccaactatgtggactccaaccccacgggcatcgtggtgtct
ccctggtgcaattgtcgtggcagtgggaacatggaagaagagtgtgagaagttcctcagg
gacttcacggaaaacccatgcctccggaatgccattcaggcctttggtaatggcacagat
gtgaacatgtctcccaaaggcccctcactcccagctacccaggcccctcgggtggagaag
actccttcactgccagatgacctcagtgacagcaccagcctggggaccagtgtcatcacc
acctgcacatctatccaggagcaagggctgaaggccaacaactccaaagagttaagcatg
tgcttcacagagctcacgacaaacatcagtccagggagtaaaaaggtgatcaaacttaac
tcaggctccagcagagccagactgtcggctgccttgactgccctcccactcctgatgctg
accttggccttgtag

DBGET integrated database retrieval system