KEGG   Rattus norvegicus (rat): 25146Help
Entry
25146             CDS       T01003                                 

Gene name
Cyp17a1, Cyp17
Definition
(RefSeq) cytochrome P450, family 17, subfamily a, polypeptide 1
  KO
K00512  steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone deacetylase [EC:1.14.14.19 1.14.14.32]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04913  Ovarian steroidogenesis
rno04917  Prolactin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Module
rno_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
rno_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    25146 (Cyp17a1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25146 (Cyp17a1)
   04917 Prolactin signaling pathway
    25146 (Cyp17a1)
   04927 Cortisol synthesis and secretion
    25146 (Cyp17a1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25146 (Cyp17a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    25146 (Cyp17a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.19  steroid 17alpha-monooxygenase
     25146 (Cyp17a1)
    1.14.14.32  17alpha-hydroxyprogesterone deacetylase
     25146 (Cyp17a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP17 family
   25146 (Cyp17a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 25146
NCBI-ProteinID: NP_036885
RGD: 2456
Ensembl: ENSRNOG00000020035
UniProt: P11715
Position
1q54
AA seq 507 aa AA seqDB search
MWELVGLLLLILAYFFWVKSKTPGAKLPRSLPSLPLVGSLPFLPRRGHMHVNFFKLQEKY
GPIYSLRLGTTTTVIIGHYQLAREVLIKKGKEFSGRPQMVTQSLLSDQGKGVAFADAGSS
WHLHRKLVFSTFSLFKDGQKLEKLICQEAKSLCDMMLAHDKESIDLSTPIFMSVTNIICA
ICFNISYEKNDPKLTAIKTFTEGIVDATGDRNLVDIFPWLTIFPNKGLEVIKGYAKVRNE
VLTGIFEKCREKFDSQSISSLTDILIQAKMNSDNNNSCEGRDPDVFSDRHILATVGDIFG
AGIETTTTVLKWILAFLVHNPEVKKKIQKEIDQYVGFSRTPTFNDRSHLLMLEATIREVL
RIRPVAPMLIPHKANVDSSIGEFTVPKDTHVVVNLWALHHDENEWDQPDQFMPERFLDPT
GSHLITPTQSYLPFGAGPRSCIGEALARQELFVFTALLLQRFDLDVSDDKQLPRLEGDPK
VVFLIDPFKVKITVRQAWMDAQAEVST
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaacttgtgggtctcttgctgctcatcctagcctatttcttttgggtcaagtca
aagacgcccggtgccaagctccccaggagccttccatccctgcccctggtgggcagtctg
ccgtttctccccagacgtggtcatatgcatgtcaacttcttcaagctacaggaaaagtat
ggtcccatctattctcttcgcctgggtaccacaactacagtgatcatcggccactatcag
ctggccagggaggtgctcatcaagaagggaaaagaattctctggtcggccccagatggtg
actcaaagcctcttgtcggaccaagggaaaggcgtggcctttgcagatgctggtagctcc
tggcacctgcaccggaagttggtgttcagcaccttttccctgttcaaggatggccagaaa
ctggagaagctaatctgtcaggaagccaagtcactgtgtgatatgatgctggcacacgac
aaggagtccatagacctgtccacgcctatcttcatgtcagtaaccaacatcatctgtgct
atctgcttcaacatctcttatgagaaaaatgatccaaaactgaccgccataaagaccttt
actgagggtatcgtggatgccacgggcgacagaaatctggtggacatattcccatggttg
acgatttttcccaacaaaggcttggaggtgataaagggttatgccaaagttcgaaatgaa
gtactgactggaatatttgaaaagtgcagggagaagttcgacagtcagtctatctccagc
ctgacggacattctgattcaagccaagatgaattcagacaacaacaacagctgtgaaggc
cgggacccagatgtgttttcagataggcacatccttgccacggtgggagacatctttggg
gcgggcatagagacaactaccactgtgctcaagtggatcctggctttcctggtgcacaat
cctgaggtgaagaagaagatccaaaaggagattgaccagtacgtaggcttcagccgaaca
ccaactttcaatgaccggtctcacctcctcatgctggaggccactatccgagaagtgctg
cgtatcaggccggtggctcccatgctcatcccccacaaggctaacgttgactccagcatt
ggagagtttactgtccccaaggacacacatgtggtcgtcaatctctgggcactgcatcac
gatgagaatgaatgggaccagccagatcagttcatgcctgaacgcttcttagatccaacg
ggaagccatctcattacacccacgcagagttacttgcccttcggagctggtccccgatcc
tgcatcggagaggctctggcccgtcaggagctctttgtcttcacggccttgctactgcag
aggtttgacttggatgtgtcagatgataaacaactgccccgcctggagggtgatcccaag
gtagtctttctgatcgaccctttcaaagtaaagatcacggtgcgccaggcatggatggat
gcacaggctgaggttagcacctag

DBGET integrated database retrieval system