KEGG   Rattus norvegicus (rat): 25149Help
Entry
25149             CDS       T01003                                 

Gene name
Esr2, ER-beta, ERbeta, Erb2
Definition
(RefSeq) estrogen receptor 2
  KO
K08551  estrogen receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04929  GnRH secretion
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    25149 (Esr2)
   04915 Estrogen signaling pathway
    25149 (Esr2)
   04917 Prolactin signaling pathway
    25149 (Esr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25149 (Esr2)
  09162 Cancer: specific types
   05224 Breast cancer
    25149 (Esr2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25149 (Esr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25149 (Esr2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    25149 (Esr2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    25149 (Esr2)
Nuclear receptors [BR:rno03310]
 3. Estrogen like
  3A. Estrogen receptor
   25149 (Esr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep ERbeta_N zf-C4
Motif
Other DBs
NCBI-GeneID: 25149
NCBI-ProteinID: NP_036886
RGD: 2582
Ensembl: ENSRNOG00000005343
Vega: OTTRNOG00000001373
UniProt: Q62986
Structure
PDB: 

Position
6q24
AA seq 485 aa AA seqDB search
MTFYSPAVMNYSVPGSTSNLDGGPVRLSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKS
PWCEARSLEHTLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCPVCSDYASGYHYGVWS
CEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCG
YRIVRRQRSSSEQVHCLSKAKRNGGHAPRVKELLLSTLSPEQLVLTLLEAEPPNVLVSRP
SMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMVGLMW
RSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMIL
LNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV
RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQ
NLQSQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacattctacagtcctgctgtgatgaactacagtgttcccggcagcaccagtaacctg
gacggtgggcctgtccgactgagcacaagcccaaatgtgctatggccaacttctgggcac
ctgtctcctttagcgacccattgccaatcatcgctcctctatgcagaacctcaaaagagt
ccttggtgtgaagcaagatcactagagcacaccttacctgtaaacagagagacactgaag
aggaagcttagtgggagcagttgtgccagccctgttactagtccaaacgcaaagagggat
gctcacttctgccccgtctgcagcgattatgcatctgggtatcattacggcgtttggtca
tgtgaaggatgtaaggccttttttaaaagaagcattcaaggacataatgattatatctgt
ccagccacgaatcagtgtaccatagacaagaaccggcgtaaaagctgccaggcctgccga
cttcgcaagtgttatgaagtaggaatggtcaagtgtggatccaggagagaacggtgtggg
taccgtatagtgcggaggcagagaagttctagcgagcaggtacactgcctgagcaaagcc
aagagaaacggtgggcatgcaccccgggtgaaggagctactgctgagcaccttgagtcca
gagcaactggtgctcaccctcctggaagctgaaccacccaatgtgctggtgagccgtccc
agcatgcccttcaccgaggcctccatgatgatgtccctcactaagctggcggacaaggaa
ctggtgcacatgattggctgggccaagaaaatccctggctttgtggagctcagcctgttg
gaccaagtccggctcttagaaagctgctggatggaggtgctaatggtgggactgatgtgg
cgctccatcgaccaccccggcaagctcattttcgctcccgacctcgttctggacagggat
gaggggaagtgcgtagaagggattctggaaatctttgacatgctcctggcgacgacgtca
aggttccgtgagttaaaactccagcacaaggagtatctctgtgtgaaggccatgatcctc
ctcaactccagtatgtaccccttggcttctgcaaaccaggaggcagaaagtagccggaag
ctgacacacctactgaacgcggtgacagatgccctggtctgggtgattgcgaagagtggt
atctcctcccagcagcagtcagtccgactggccaacctcctgatgcttctttctcacgtc
aggcacatcagtaacaagggcatggaacatctgctcagcatgaagtgcaaaaatgtggtc
ccggtgtatgacctgctgctggagatgctgaatgctcacacgcttcgagggtacaagtcc
tcaatctcggggtctgagtgcagctcaacagaggacagtaagaacaaagagagctcccag
aacctacagtctcagtga

DBGET integrated database retrieval system