KEGG   Rattus norvegicus (rat): 25151
Entry
25151             CDS       T01003                                 

Gene name
Igf2r, IGF-IIR, Igfr2
Definition
(RefSeq) insulin-like growth factor 2 receptor
  KO
K06564  insulin-like growth factor 2 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25151 (Igf2r)
   04142 Lysosome
    25151 (Igf2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25151 (Igf2r)
   04090 CD molecules [BR:rno04090]
    25151 (Igf2r)
   04091 Lectins [BR:rno04091]
    25151 (Igf2r)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25151 (Igf2r)
CD molecules [BR:rno04090]
 Proteins
  25151 (Igf2r)
Lectins [BR:rno04091]
 P-type lectins
  25151 (Igf2r)
SSDB
Motif
Pfam: CIMR ATG27 Man-6-P_recep fn2 PRKCSH_1
Other DBs
NCBI-GeneID: 25151
NCBI-ProteinID: NP_036888
RGD: 2871
Ensembl: ENSRNOG00000014997
UniProt: G3V824
Position
1q11
AA seq 2481 aa
MRAVLPGPVPSGPRVALLLPLLLLLLVAAAGSAQAQAVDLDALCSYTWEAVDSKNNAVYK
INPCGHVDNPRCGPTSAVCMCDLKSENCRSVGDSLLRSSAKSLLEFNTTTGCQPSEHRIQ
TSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKADKEVPCYVFDDKLQKHDLN
PLIKLNGGYLVDDSDADASLFINVCRDIDSLRDPSTQLRVCPAGTAACLLKGNQAFDVGR
PKEGLKLLSKDRLVLTYVKEEGEKPDFCNGHSPAVTVTFVCPSERREGTIPKLTAKSNCR
YEVEWITEYACHRDYLESETCSLSSEQHDIAIDLSPLAQHEEGSPYVADGGEYRFFMNVC
GDTKVSLCNKEAAVCQEKKVDSTQVKIAGRHQNQTLRYSDGDLTLIYSGGDECSSGFQRM
SVINFECNKTAGQDGRGEPVFTGEVDCTYFFTWDTKYACVKEKEDLLCGAIDGKKRYDLS
VLARHSESEQNWEAVDGSQAESEKRNFFINVCHRVLQAGKAKNCPEGAAVCAVDKSGSKN
LGKFVSSPTKEKGHIQLSYSDGDDCGNDKKITTNITFVCKPGDLESAPVLRAAGPDGCSY
EFEWHTAAACVLSQTEGENCTVLDAQAGFSFDLSLLTKKNGAYKVETDKYDFYINVCGPV
SVNLCQSNSGACQVAKSGKSWNLGLSNTKLTYYDGMIQLSYRNGTLYNNEKHTPRSTLIT
FLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECMVTDPSMMEQYDLSSLVKFEG
GRGGNWYAMENSREHFTRRKYYLNVCRPLNPVPGCDRYASACQMKYENNEGSLAETVAIS
NLGVAKTGPVVEESGSLLLEYVNGSACTTSDGRLTTYSTRIHLVCGRGTMNSHPIFTFNW
ECVVSFLWNTEAACPIQTITDSDQACSIRDPNSGFVFNLSPLNYSQGHMVLGIGKTFVFN
ICGTMPACGTVAGKPALGCEAETKIKDIKDLKPERPVGMEKSLQLSAEGFLTLTYKGSSP
SDRGTAFIIRFICNGDIYPGTPKFLHQDIDSARGIRNTFFEFETALACIPSVVDCQVTDP
AGNEYDLSALSMVRKPWTAVDTSVHGKKRRFYLSVCTPLPYIPGCDGIAMGSCMVSEDKS
QNLGVVQISPQATGNGSLSILYVNGDRCGNQRYSTRIVFECAQTSGSPMFQLLNNCEYVF
VWRTVEACPVVREEGDNCQVKDPRHGNLYDLKPLALNDTIISAGEYTYYFRVCGKLSLDV
CSAHDGSKAVSSCQEKKGPQGFQKVAGLLNQKLTFENGLLKMNYSGGDTCHKVYQRSTTI
YFYCDRTTQKPVFLKETLDCSYLFEWRTQYACPPFNVTECSIQDEAGNSIDLSSLSRYSD
NWEAVTRTGATEHYLINVCKSLSPQAGTDPCPPEAAVCLLDGSKPVNLGRVRDGPQWTAG
VTVLKYVDGDLCPDKIRKRSTIIRFTCSDSQVNSRPLFISAVQDCEYTFSWPTPAACPVK
SNIHDDCQVTNPSTGHLFDLSSLSGKAGITASYSEKGMVFMSICEENVNCSPGVGACFGQ
TRISVGQASKRLSYKDQVLQLVYENGSPCPSKSGLRYKSVISFVCRPEAGPTNRPMLISL
DKQSCTLFFSWHTPLACEQATECTVRNGSSIIDLSPLIHRTGGYEAYDESEDDTSDTTPD
FYINICQPLNPMHGVPCPAGASVCKVPVDGPPIDIGRVTGPPIFNPVANEVYLNFESSTP
CLADKYMNYTSLIAFHCRRGISMGTPKLIRNNDCDFVFEWETPIVCPDEVKTQGCAVTDE
QLLYSFNLTSLSTSTFKVTRDAHTYSIGVCTTAADLDQEGCKDGGVCLLSGSKGASFGRL
ASMQLDYRHQDEAVILSYVNGDPCPPETEDGEPCVFPFIYKGETYDECVLEGRAKLWCSK
TANYDRDHEWGFCRPSNSHRMSAIIFTCDENEDIGRPEVFSEDRGCEVTFEWKTKVVCPP
KKMECKFVQKHKTYDLRLLSSLTGSWDFVHEGNSYFINLCQRVYKGPLDCSERASICKKS
ATGQVQVLGLVHTQKLEVIDETVLVTYSKGHSCGGNKTASSVIELTCAKTVGRPAFKRFD
IDSCTYYFYWYSRAACAVRPQEVNMVNGTLTNPVTGKSFSLGEIYFKLFSASGDMRSNGD
NYLYEIQLSSISSSSNPACSGANICQVKPNDQHFSRKVGTSDMTKYYVQDGDLDVVFTSS
STCGKDKTKSVSSTIFFHCDPLLKDGVPEFSHETADCQYLFSWYTSAVCPLGVDFDDENA
VPEYKGLSERSQAVGAVLSLLLVALTGCLLALLLHKKERRETVINKLTNCCRRSSGVSYK
YSKVSKEEETDENETEWLMEEIQVPAARLGKDGQENGHITTKTVKAEALTSLHGDDQDSE
DEVLTIPEVKVHTGRGAEVESSQPLRNPQRKVLKEREGERMGLVRGEKARRGKFRPGQRK
PTTPAKLVSFHDDSDEDLLHI
NT seq 7446 nt   +upstreamnt  +downstreamnt
atgcgggccgttctgccgggacccgtgccctccgggccgcgcgtcgcgctcctgctgccg
ctcctgctgctgctgctcgtggcggccgcgggctccgcgcaggcccaggccgtggacttg
gacgccttgtgcagttacacatgggaagctgttgattccaaaaataatgcagtttataaa
atcaacccctgtggacatgtggataatcccaggtgtgggccgacaagtgctgtctgtatg
tgtgacctaaagtcagaaaactgccggtcagtgggtgactcacttttgagaagttcagcc
aaatcactcctggaatttaacaccactacgggctgccagccttcagagcacagaatccag
actagcattacatttctgtgtgggaagaccctgggaactcctgaatttgtaactgccaca
gactgtgtgcattacttcgaatggaggactactgcagcctgcaagaaagacatatttaaa
gctgataaggaggtgccatgctatgtatttgatgacaagttacagaagcatgatttgaac
ccactgatcaagctgaatggcggctacctggtggatgactctgacgctgacgcatctctg
ttcatcaatgtgtgtagagacatagactcccttcgggaccccagcacacagctgagagtc
tgccctgctggcactgctgcctgtctgctgaaggggaaccaggcatttgatgttggccgg
cccaaggaggggctgaagctattgagcaaggacaggctcgttctgacttatgttaaggaa
gaaggagaaaagccagacttctgtaatggtcacagccctgcagtgacagtaacatttgtg
tgcccatctgagcggagagagggcaccattcctaaactcactgccaagtccaactgtcgc
tatgaagttgagtggatcactgagtatgcctgccacagagattacttggagagtgaaacc
tgctccctcagcagtgagcagcatgatattgctattgaccttagtcccttggcccagcat
gaagaagggtccccctatgtagctgatggaggagaatataggttttttatgaatgtctgt
ggggacacaaaggtctcactctgtaacaaagaggctgctgtttgtcaagagaaaaaggtg
gattccactcaagtcaaaatagcaggaagacaccagaaccagacactccggtactcagat
ggagatctcaccctaatctattctggaggtgatgagtgtagttccggcttccagcggatg
agtgtcataaactttgagtgcaacaaaaccgcaggtcaagatgggagaggagagcctgtg
ttcacaggtgaggtggactgcacatacttcttcacgtgggacactaaatatgcctgtgta
aaagagaaggaagatctcctctgcggggccatcgacggcaagaaacgttacgacctgtct
gtgctggctcgtcactcagaatcagaacagaattgggaagcagtggatggcagccaggct
gagtcagaaaagaggaatttcttcatcaatgtctgtcaccgggtgctgcaggcgggaaag
gccaagaactgtcctgaaggtgctgccgtgtgtgctgtggataagagtggaagtaaaaat
ctaggaaaatttgtctcttctcctacaaaagagaaaggacacattcagctctcttactct
gatggcgatgactgtggtaatgataagaaaataacaactaacatcacatttgtgtgcaaa
ccaggtgatctggaaagtgctccagtgctgagagctgcagggcccgatggctgctcctat
gagtttgagtggcacacagctgctgcctgtgtcctgtcgcagacggagggagaaaactgc
actgtccttgatgctcaggcagggttttcttttgatttgtcactcctcacaaagaagaat
ggtgcatataaagttgagacagacaagtatgacttctacataaatgtttgtggccctgta
tccgtgaacctgtgtcagtcaaactcaggagcctgccaggtagcaaaaagtggtaagtct
tggaacttggggctgagtaatactaagcttacgtactatgatgggatgatccagctgagc
tacaggaatggcacgctgtataacaatgaaaagcacacaccgagatccacactgattacc
ttcctctgtgaccgtgatgctggagtgggcttcccagaatatcaggaagaggacaactct
acctacaacttccggtggtacaccagttatgcttgcccggaagagcccctggagtgcatg
gtgacagacccctccatgatggagcaatatgacctctccagtctagtgaagtttgaaggt
ggccgtggaggaaactggtatgccatggaaaactcccgagaacatttcacacggaggaaa
tactacctcaacgtgtgccggcctctgaatcctgtgccaggctgtgatcgatatgcatct
gcttgccagatgaaatacgaaaacaatgagggctccttggcagagactgtggccatcagt
aacttgggagttgcaaagacaggccctgtggtggaggagagcggcagcctcctcttagag
tatgtgaacggctctgcgtgcaccaccagtgatggccggctaaccacctacagcaccagg
atccatcttgtgtgtggtcgaggaactatgaattcccatcccatattcactttcaactgg
gaatgtgtggtcagtttcttgtggaacacggaggctgcctgccccatccagacgatcaca
gattcagaccaggcttgctctataagggaccccaacagcggatttgtgtttaatctgagc
ccacttaactattctcaaggacacatggtcttaggcattgggaagacttttgtgttcaat
atctgtggtacaatgcctgcctgtggaacggttgcagggaagccagcccttggctgtgag
gcagaaactaagatcaaagacattaaggatctgaagccagaaaggccagtcgggatggag
aagagcctccagttgtctgccgaggggttcctcactctgacctacaaaggctcttctcct
tctgacagaggcacagccttcatcatccgtttcatttgcaatggtgacatttacccaggg
acccccaagttcctgcatcaggacattgactctgcacgagggatccggaacaccttcttt
gagtttgaaactgcattggcttgtattccttctgtagtggattgtcaagtgactgaccca
gctgggaacgagtacgacctgagtgccctgagcatggtcaggaagccgtggactgctgtg
gacacgtctgtgcatgggaagaagaggcgcttctatctgagcgtgtgcaccccactgcct
tacattcctggctgcgatggcattgcaatggggtcctgcatggtgtcagaagacaaaagt
cagaacttgggtgtggtgcagatcagtcctcaagctactggaaacggatctctcagcatc
ctgtatgtgaatggggataggtgtggaaaccagcgctactccaccaggatagtgttcgaa
tgtgcccagacgtcgggctcacctatgttccagctcctgaacaactgtgagtatgtgttt
gtgtggcgaacagtggaggcctgccctgtggtcagagaggaaggagacaactgccaggtg
aaagaccccagacacggcaatttgtatgacctgaagcccctggccctcaatgacaccatc
atcagtgctggcgagtacacctactacttccgggtctgtggaaagctgtccttagatgtg
tgctctgcccatgatgggtccaaggcagtctcatcatgccaggaaaagaaaggaccacaa
ggattccagaaagtggcagggctccttaatcagaagctgactttcgaaaatggactgttg
aaaatgaactacagtgggggggacacctgccataaggtgtatcagcgctccacaaccatc
tatttctactgtgaccggacgactcagaagccagtgtttctgaaggaaactttggactgc
tcctatttgtttgagtggcgaacacagtatgcctgcccacctttcaatgtgacagagtgc
tctatccaggatgaggctggcaactccattgacctctcctcactgtcaagatacagtgac
aactgggaggctgtgaccaggacaggggccactgagcattacctcatcaacgtatgcaag
tctctgtctccacaggctggcacagatccatgccctccagaggcagctgtttgtctgctg
gatggctccaagcctgtgaacctcggcagggtgagggatggtcctcagtggacagctggt
gtgactgtcctgaagtatgtggatggtgacttgtgccccgacaaaattcggaaaaggtca
accattattcgcttcacctgcagtgacagccaagtgaactccaggcctctgttcatcagt
gctgtacaggactgtgagtacacattttcctggcccacacctgctgcctgtcctgtgaag
agcaacatacacgatgactgccaagtcaccaaccccagcacaggccacctgtttgacctg
agctccctaagtggcaaagctggcatcacagcctcctacagcgagaaggggatggtcttc
atgagcatctgtgaggagaatgtgaactgtagccctggagtaggggcctgctttggacag
accaggatcagtgtgggccaggccagcaagaggctgagctacaaggatcaggtcttgcag
ctggtgtatgagaatgggtccccatgcccctccaagtcaggcctgaggtacaagagtgtc
atcagcttcgtgtgccggccggaggctggacccaccaacaggcccatgctcatctccttg
gacaagcagtcgtgtacactcttcttctcctggcacacgcccctggcctgtgagcaggcg
acggaatgcaccgtgcggaatggaagctcgattattgacctgtcacctctcatccaccgc
actggtggttatgaagcatacgatgagagtgaggacgacacctctgataccacccctgac
ttctacatcaacatctgtcagccactgaatcccatgcatggagtgccctgccctgcaggc
gcctcagtatgcaaagtccccgtggacgggccccctatagatattgggagagtcacaggc
cctccaatattcaatcccgtggccaatgaggtctacctgaactttgagagcagcactcct
tgcttagcggacaaatatatgaactacacctcactaattgcgtttcactgcaggagaggg
atcagcatgggaactcctaagctgataaggaacaatgactgtgactttgtgtttgagtgg
gagactccgattgtctgtcctgacgaagtgaagacacagggctgtgctgtaacagatgag
cagctgctctatagcttcaacctgacgagcctttccacaagcactttcaaagtcactcgg
gacgctcacacatacagtataggggtgtgcacaacggcagctgacttagaccaggaaggc
tgcaaggacggcggggtctgtctgctctctgggagcaaaggagcttcttttgggcgccta
gcgtcgatgcagctggattacaggcaccaggatgaagcagtcatcctgagttatgtgaac
ggtgatccttgccctccagaaacggaagatggcgagccctgtgtcttccccttcatttac
aaaggggagacctatgacgaatgtgtattagagggacgagcgaaactgtggtgtagcaaa
actgcgaattacgatcgtgaccacgagtggggcttctgcagaccgagcaacagtcaccgg
atgtctgcgatcatatttacttgtgatgagaacgaagatattgggaggccagaagtgttc
agtgaagatcgtgggtgtgaggtgacatttgagtggaaaacaaaagttgtctgccctccg
aagaagatggagtgcaagtttgttcagaagcataaaacctatgacttgcgattgctctca
tccctcacggggtcctgggattttgtgcatgaaggaaactcgtactttatcaatctgtgc
caaagagtatataaaggtcccctggactgctctgagagagccagcatttgcaagaagagt
gccactggtcaagtccaggttttggggcttgttcatactcaaaaactggaagtcatagat
gaaacagtccttgtcacttactcaaaaggccattcttgtggtgggaataagactgcatcc
tcagtgatcgagttgacctgtgcaaagactgtgggcaggcctgcattcaagaggtttgat
attgacagctgcacctactacttttactggtactcacgggctgcctgtgctgtgagacct
caggaggtgaacatggtgaatggaactcttaccaaccctgtgactggcaagagcttcagc
ctcggggaaatttattttaagctgttcagcgcctctggggacatgagaagcaatggggac
aactatctgtatgagatccagctctcctctatctccagctcttctaaccctgcgtgctcc
ggtgccaacatctgccaggtgaagcccaatgaccagcacttcagcaggaaagtgggcacc
tctgacatgaccaagtactacgtccaagacggtgatctggatgtggtgtttacctcttcc
tccacgtgtggcaaagataagaccaagtctgtgtcttccaccatcttcttccactgtgac
cctctgctgaaggacggggtccccgagttcagccacgagactgctgactgccagtacctt
ttctcctggtacacttcagctgtgtgtcctctgggtgtggactttgatgatgagaatgct
gtgccagagtataaagggctctcagagcggagtcaggccgttggggcagtcctcagtctc
ctcctggtggcactgactggctgtctgctggccttgctgcttcataagaaggagagaagg
gaaactgtgataaacaagctgaccaattgctgcagaaggagctcgggggtgtcctataag
tactcaaaggtcagcaaggaggaggagacagatgagaatgagacagaatggctgatggaa
gagatccaggtgccagccgccagactaggcaaggacgggcaggagaacggccacattacc
accaagacggtgaaagcagaagctctcacttccctgcatggggatgaccaagacagtgag
gatgaggtcctgaccatcccagaggtgaaagttcacacaggcagaggagccgaggtggaa
agctcacagcccctgagaaatccccagcgcaaggtcctgaaggaaagggagggggagagg
atggggctggtccgcggtgagaaggccagaagagggaagttcagacccggacagcgcaag
ccaacaacccctgccaagctggtgtccttccatgatgacagtgacgaggacctcctacac
atctga

DBGET integrated database retrieval system