KEGG   Rattus norvegicus (rat): 25154
Entry
25154             CDS       T01003                                 

Gene name
Pgr
Definition
(RefSeq) progesterone receptor
  KO
K08556  progesterone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    25154 (Pgr)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    25154 (Pgr)
   04914 Progesterone-mediated oocyte maturation
    25154 (Pgr)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    25154 (Pgr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25154 (Pgr)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    25154 (Pgr)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    25154 (Pgr)
Nuclear receptors [BR:rno03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   25154 (Pgr)
SSDB
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 25154
NCBI-ProteinID: NP_074038
RGD: 3317
UniProt: Q63449
Position
8q11
AA seq 923 aa
MTELQAKDPRTLHTSGAAPSPTHVGSPLLARLDPDPFQGSQHSDASSVVSPIPISLDRLL
FSRSCQAQELPDEKTQNQQSLSDVEGAFSGVEASRRRSRNPRAPEKDSRLLDSVLDTLLA
PSGPEQSQTSPPACEAITSWCLFGPELPEDPRSVPATKGLLSPLMSRPESKAGDSSGTGA
GQKVLPKAVSPPRQLLLPTSGSAHWPGAGVKPSQQPATVEVEEDGGLETEGSAGPLLKSK
PRALEGMCSGGGVTANAPGAAPGGVTLVPKEDSRFSAPRVSLEQDAPVAPGRSPLATTVV
DFIHVPILPLNHALLAARTRQLLEGDSYDGGAAAQVPFAPPRGSPSAPSPPVPCGDFPDC
TYPPEGDPKEDGFPVYGEFQPPGLKIKEEEEGTEAASRSPRPYLLAGASAATFPDFPLPP
RPPRAPPSRPGEAAVAAPSAAVSPVSSSGSALECILYKAEGAPPTQGSFAPLPCKPPAAS
SCLLPRDSLPAAPTSSAAPAIYPPLGLNGLPQLGYQAAVLKDSLPQVYPPYLNYLRPDSE
ASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCI
VDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDGVALPQSVAFPNESQTLG
QRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQLGERQLLSVV
KWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMK
ELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSSYIR
ELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRALAVEFPEMMS
EVIAAQLPKILAGMVKPLLFHKK
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgactgagctgcaggcaaaggatccgcggactctccacacatctggcgccgcgccctcc
cccacccacgtcgggtctcccttgcttgcacgcttggacccggatcccttccaggggagt
cagcactcggacgcatcgtctgtagtctcgccaataccgatctccctggaccggctgctc
ttctctcggtcctgccaggctcaggagctcccagacgaaaagacacaaaatcagcagtcg
ctgtccgacgtggagggagctttctctggagtggaagcctcgcgccgaagaagcagaaat
cccagagctccggagaaggacagcagactcttagacagtgtcttagacaccctgttggcg
ccctcggggcccgagcaaagccaaaccagccctccagcctgcgaggccatcacttcttgg
tgtctctttgggccagagcttccagaagacccccgcagtgtccccgctaccaaggggttg
ttgtccccgctcatgagccggccagagagcaaggctggcgacagctccgggacaggagca
gggcagaaggtgctgcccaaagcggtgtcaccaccccggcagctgttgctcccgacctcg
gggagtgctcactggcccggggcaggggtgaagccatctcagcagcctgctacggtggag
gtggaggaggacggtggtctcgagaccgagggctctgcgggtccgcttctgaagagcaaa
cctcgagcactggaaggcatgtgtagcggaggaggagtcacagccaacgcgcccggcgcg
gccccaggaggcgtcaccttggtccccaaggaagattcccggttttctgctcccagggtc
tccttggagcaagacgctccagttgcccccgggcgctccccactggccaccacagtggtg
gatttcattcacgtgcccattctgcctctgaaccacgctctcctagccgcccgcacccgg
cagctgctggagggagacagctacgacggcggggctgcagcgcaagtcccttttgctcca
cctcggggctcgccctccgcgccatccccgccggtgccctgcggtgacttcccagactgc
acctaccctccagaaggcgaccctaaagaggacgggttcccagtttacggcgaattccag
cctcccggcttgaagatcaaggaggaggaggagggcacggaggctgcttcccgctcgccg
cgcccctacctgttggccggagccagcgccgccaccttcccagacttcccgctgccgccg
cggccgccgcgagcgccaccctccaggcccggagaggcggcggtagccgccccgagcgcc
gcggtgtcgccagtgtcctcgtcgggctccgcactggagtgcatcctgtacaaagcggag
ggcgcgccgcccacgcagggttcgttcgccccattgccctgtaaacccccggccgccagc
tcctgcctgcttccccgggacagcctgcccgccgctccgacctcctcggcagcaccggcc
atctacccgccgctcggcctcaatgggctccctcagctgggttaccaggccgcggtgctc
aaggacagcctgccccaagtctacccgccctacctcaactacctgaggccagattcagaa
gccagccagagcccacaatatggctttgattccttacctcagaagatctgtttaatctgc
ggggatgaagcatctggctgtcactatggtgtgcttacctgtgggagctgcaaggtcttc
tttaagagggcgatggaagggcagcataactatttatgtgccggaagaaatgattgcatt
gttgataaaatccgcagaaaaaactgtccagcatgtcgtctgagaaagtgctgtcaggct
ggcatggtccttggaggtcgtaagtttaagaagttcaataaagtccgagttatgagagcc
ctcgatggtgttgctctcccccagtcagtggcctttcctaatgagagccagaccctgggc
cagagaatcacattttcaccaaatcaagagattcaactggttccgccactcatcaacctg
ctcatgagcattgaacctgatgtggtttatgcagggcatgacaacacaaagcccgacact
tccagctctttgctgaccagtctcaaccaactaggcgagaggcagctgctttcagtagtc
aaatggtctaagtctctgccaggtttccggaacttacacatcgatgaccagataaccctg
attcagtactcctggatgagcctgatggtgtttggcctggggtggaggtcgtacaagcat
gtcagtggacagatgctatattttgcacctgatctaatcctgaatgagcagaggatgaag
gagttgtcattctactcgctgtgccttaccatgtggcaaatcccacaggagtttgtcaag
ctccaggtgacccacgaggagttcctctgtatgaaagtcttacttcttcttaacacaatt
cctttggaaggcctgaggagtcaaagccagtttgaagagatgaggtcaagctatattcgg
gaattgatcaaggcaattggcttaagacagaaaggggtggtccccagttcacaacgcttc
tatcaacttacaaaacttcttgacagcttgcatgatcttgtgaaacagctccacctgtac
tgcttgaatacgttcatccaatcccgggcactggctgtggaatttccggaaatgatgtct
gaagttattgctgcccagttgcccaagatcctggcgggcatggtgaagcctctcctcttt
cacaaaaagtga

DBGET integrated database retrieval system