KEGG   Rattus norvegicus (rat): 25156
Entry
25156             CDS       T01003                                 

Gene name
Vav1
Definition
(RefSeq) proto-oncogene vav
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05205  Proteoglycans in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25156 (Vav1)
   04024 cAMP signaling pathway
    25156 (Vav1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25156 (Vav1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25156 (Vav1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25156 (Vav1)
   04660 T cell receptor signaling pathway
    25156 (Vav1)
   04662 B cell receptor signaling pathway
    25156 (Vav1)
   04664 Fc epsilon RI signaling pathway
    25156 (Vav1)
   04666 Fc gamma R-mediated phagocytosis
    25156 (Vav1)
   04670 Leukocyte transendothelial migration
    25156 (Vav1)
   04062 Chemokine signaling pathway
    25156 (Vav1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25156 (Vav1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25156 (Vav1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25156 (Vav1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    25156 (Vav1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   25156 (Vav1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH2 SH3_9 C1_1 PH CDC24 LZ3wCH C1_2 DUF4335 PH_16 PH_10
Other DBs
NCBI-GeneID: 25156
NCBI-ProteinID: NP_036891
RGD: 3951
Ensembl: ENSRNOG00000050430
UniProt: Q5BK91
Position
9
AA seq 843 aa
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLWPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEDSALGDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRS
ESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNI
EELLSVHTHFLKELKDALSGPGATMLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDTTEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLANYGRPKIDGELKITSVERRSKT
DRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDSSGERDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCYRCRAPAHKECLGRVPPCGRQDFSGTMKKDKLHRRAQDKKRNELGLPKMEVCQE
YYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVRPYVHGP
PQDLSVHLWYAGPMERAGAEGILTNRSDGTYLVRQRVKDTAEFAISIKYNVEVKHIKIMT
SEGLYRITEKKAFRGLPELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAINKPPVGSTK
YFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDYS
EYC
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggagctctggcgacagtgcacccactggctgatccagtgtcgggtgctgcctcccagc
caccgtgtgacctgggagggggcccaggtgtgtgagctggcacaggcactgcgggatggt
gtcctcctgtgtcaactgcttaacaacctgctcccccacgccatcaatctgcgggaagtt
aacttgtggccccagatgtcccagttcctttgtcttaagaacatccgaaccttcctgtct
acttgctgtgagaaattcggcctcaagcgcagcgaactctttgaggcttttgacctcttt
gatgtgcaggactttggaaaggtcatctacaccctgtctgccctgtcatggacacccatt
gcccagaacaaagggatcatgcccttcccaacagaggacagcgccctgggtgatgaagat
atttacagtggcctttcagaccagattgatgacaccgcagaggaagatgaggacctttat
gactgcgtggagaatgaggaggcagagggggacgagatctacgaggacctaatgcgctcg
gagtcggtgcccacacctcccaagatgacagagtacgataagcgctgctgctgcctgcgg
gagatccagcagactgaggagaagtacacagacacactgggctccatccagcagcacttc
atgaagcccctccagcgattcctcaagcctcaagacatggagaccatctttgtcaacatt
gaggagctgctctctgtgcacacccacttcttaaaggaactgaaggatgccctgtctggc
ccgggagcaacgatgctgtatcaggtcttcatcaagtataaggagaggttccttgtttat
ggccgttattgcagtcaggtggagtcagccagcaagcacttggatcaagtggccacagca
cgggaggatgtgcagatgaagctggaggaatgctctcaaagagccaacaatggccgcttc
accctgcgggatctgctgatggtgcctatgcagcgggtgctgaagtatcacctcctcctc
caggagctagtgaaacacacacaggatactacagaaaaggagaacctgcggttggccctg
gacgccatgagggacctggcgcagtgtgtgaatgaggtcaagagggacaatgaaacctta
cggcagatcacaaactttcagctgtccattgagaacctggaccagtctctggccaactat
ggccggcctaagattgacggtgagctcaagattacctcagtggaacggcgctccaagaca
gacaggtatgccttcctgctggacaaagcactgctcatctgtaagcgccgcggggactct
tatgacctcaaggcctcagtgaacctgcacagcttccaagttcgggatgactcttccggg
gagcgggacaacaagaagtggagccacatgttccttctgattgaggatcaaggtgcccag
gggtatgagctgttcttcaagactcgggagctaaaaaagaagtggatggaacagtttgaa
atggccatctccaacatctacccagaaaatgctacagccaatggacatgattttcagatg
ttctcctttgaggagaccacttcctgcaaggcctgccagatgttactcaggggcacattc
taccagggatatcgctgttacaggtgccgtgcacccgcacacaaggagtgtctgggaagg
gtgcctccatgtggccgtcaagatttctcaggaaccatgaagaaggacaagctacatcga
agggcccaggacaagaaaaggaatgaattgggccttcctaagatggaggtgtgtcaggaa
tactacgggatccctcctcctcccggagcctttgggccatttctgcggctcaaccctggg
gacattgtggaactcactaaggcagaggctgaacacaactggtgggagggaagaaataca
gctacgaatgaagtcggctggtttccctgtaacagagttcgtccctacgtccacggccct
ccccaggacctgtctgtgcacctctggtatgcgggccccatggagcgagcaggcgccgag
ggcatcctcaccaaccgctctgatgggacctacctggtgcggcaaagggtgaaagataca
gcggaattcgccatcagcattaagtataatgtggaggtcaagcatattaaaatcatgacg
tcagaggggttgtaccgcatcacagagaagaaggctttccggggcctcccggaactggta
gagttttatcagcagaattccctaaaagattgcttcaagtcgttggacaccaccttgcag
tttccttacaaggaacctgagaggagagccatcaacaagccgccggttggaagcaccaag
tattttggcactgccaaagcccgctacgacttctgtgcccgggaccgatcggaactgtcc
cttaaggagggtgacatcatcaagatcctcaacaagaagggacagcaaggctggtggcgt
ggggagatctatggccggattggctggtttccctctaactatgtggaggaagactattct
gaatactgctga

KEGG   Rattus norvegicus (rat): 295378
Entry
295378            CDS       T01003                                 

Gene name
Vav3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05205  Proteoglycans in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    295378 (Vav3)
   04024 cAMP signaling pathway
    295378 (Vav3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    295378 (Vav3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    295378 (Vav3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    295378 (Vav3)
   04660 T cell receptor signaling pathway
    295378 (Vav3)
   04662 B cell receptor signaling pathway
    295378 (Vav3)
   04664 Fc epsilon RI signaling pathway
    295378 (Vav3)
   04666 Fc gamma R-mediated phagocytosis
    295378 (Vav3)
   04670 Leukocyte transendothelial migration
    295378 (Vav3)
   04062 Chemokine signaling pathway
    295378 (Vav3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    295378 (Vav3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    295378 (Vav3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    295378 (Vav3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    295378 (Vav3)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   295378 (Vav3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 Filamin PH_10 LZ3wCH C1_2 IQ_SEC7_PH Prok-RING_1 Zn_ribbon_17 Spt5_N
Other DBs
NCBI-GeneID: 295378
NCBI-ProteinID: NP_001178643
RGD: 1565941
Ensembl: ENSRNOG00000020485
UniProt: F1LWB1
Position
2
AA seq 847 aa
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRPHSINLKEI
NLRPQMSQFLCLKNIRTFLAACCDTFGMKKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVNDEDIYKGLPDLIDETRVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQAKSQENDIRSCCLAEIRQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPD
LVKVHRSLMQEIHDSIVNKDDHNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDPMEKSNLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCRVCQMLLRGTFYQ
GYLCFKCGAKAHKECLGRVDNCGRVNSVEQGPFKPPEKRTNGLRRASRQVDPGLPKMRVI
RNYTGTPPPALHEGPPLHIQAGDTVELLRGEAHTVFWQGRNLASGEVGFFPSDAVKPSPC
VPKPVDYSCQPWYAGPMERLQAETELINRVNSTYLVRLRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHASGQRGNRT
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDMVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgctcagtggctcatccactgcaaagtgctgcccgccaac
caccgggtgacctgggactcggcgcaggtgttcgacctggcgcagaccctccgcgatgga
gtcctgctctgccagctgctcaacaacctgcggccacactccatcaatctgaaggagatc
aacctgagaccccagatgtcccagtttctctgtctgaagaatatccggacatttctggcc
gcctgctgtgacacgttcggaatgaagaaaagtgagctttttgaggcatttgacctattc
gatgttcgtgactttggaaaggttatagaaacattatctcgcctatcccgaacaccaata
gcattggccacaggaatcaggccattccccacggaagaaagtgtaaatgatgaagacatc
tacaaaggccttcctgacctgatagatgaaacccgtgtggaggacgaagaagacctctat
gactgtgtgtacggggaggatgaaggcggagaagtctatgaagatttgatgaaggcggag
gaggctcaccaagctaaatcacaagaaaatgatatacggagttgttgcctagcagaaatt
aggcagacagaagaaaaatacacagaaactttggagtcaatagaaaaatatttcatggca
ccattgaaaagatttctgacagcggcggaatttgattcagtatttatcaacattcctgac
cttgtaaaagttcatcggagcttaatgcaagagattcacgattccattgtaaataaagat
gaccataacttgtatcaagtttttattaactacaaggaaagattggttatttatggacag
tactgcagtggagtggagtcagccatctctagcctagactacatctctaagacaaaagaa
gatgtcagactgaaactagaggaatgttcaaagagagccaataatgggaaatttactctg
cgtgatttgctggtagttcccatgcagcgggtgctgaaatatcacctcctccttcaggag
ctggttaaacacacccatgatcccatggagaagtcgaacctgaagctggctctggatgca
atgaaggacttggcacaatatgtgaatgaagtaaaaagagataatgagacccttcgtgaa
attaagcagtttcagctatctatagaaaatttgaaccagcccgttttgctctttgggcga
ccgcagggagacggtgaaatccgaataaccacactggacaagcatacgaaacaagaaagg
catatcttcttattcgatctggcagtgattgtctgtaaaaggaaaggggataactacgag
atgaaggaaataatagatctccagcagtacaagatcgccaacaaccctaccacggataaa
gagaataaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggctg
gaattttattgcaaaacaaaagatttaaagaaaaaatggctggaacagtttgaaatggct
ttatccaacataaggccggactatgcagactccaatttccatgacttcaagatgcacaca
ttcactcgggtgacatcctgtagggtctgccaaatgctcctgagggggacattttatcaa
ggctacttatgttttaagtgtggagcaaaagcgcataaagaatgtttgggaagagtagac
aattgtggcagagttaattccgttgaacaagggccattcaaaccaccggagaagcggacc
aatggacttcggagagcttccagacaggtggatccaggcttgccgaagatgcgggtcatt
aggaactacactggcaccccgcccccagctcttcacgaaggaccaccgttgcatatccag
gcaggggacactgttgaacttctgagaggagaggcacacactgttttctggcagggacga
aacttagcttcaggagaggttggatttttcccaagcgatgctgtcaagccatctccatgt
gtacctaaaccagtagattattcttgccaaccctggtatgctggcccaatggaaagattg
caggcagaaactgaacttattaacagggtgaatagcacttaccttgtaaggctcaggacc
aaagagtctggagaatatgcaattagcattaagtacaataatgaagcaaaacacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagcttaatg
gaacttgtggagtactacaagcaccattctcttaaagaagggttcaggaccttagatacg
acgctacagtttccatacaaggagcctgaacacgcatctggacagaggggtaatagaaca
ggcaacagcttgctaagtcccaaagttctgggcattgccatcgctcggtatgacttctgt
gcaagagatatgcgggagctctccctattgaaaggagacatggtgaagatttacacaaag
atgagtgcaaatggctggtggagaggagaagtaaatggcagggtgggctggtttccatcc
acgtatgtggaagaagacgagtaa

KEGG   Rattus norvegicus (rat): 296603
Entry
296603            CDS       T01003                                 

Gene name
Vav2
Definition
(RefSeq) guanine nucleotide exchange factor VAV2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05205  Proteoglycans in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    296603 (Vav2)
   04024 cAMP signaling pathway
    296603 (Vav2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    296603 (Vav2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296603 (Vav2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    296603 (Vav2)
   04660 T cell receptor signaling pathway
    296603 (Vav2)
   04662 B cell receptor signaling pathway
    296603 (Vav2)
   04664 Fc epsilon RI signaling pathway
    296603 (Vav2)
   04666 Fc gamma R-mediated phagocytosis
    296603 (Vav2)
   04670 Leukocyte transendothelial migration
    296603 (Vav2)
   04062 Chemokine signaling pathway
    296603 (Vav2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    296603 (Vav2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    296603 (Vav2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    296603 (Vav2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    296603 (Vav2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   296603 (Vav2)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH SH2_2 CDC24 PH_10 Zn_ribbon_17 C1_2 zf-RING-like
Other DBs
NCBI-GeneID: 296603
NCBI-ProteinID: NP_001100033
RGD: 1306285
Ensembl: ENSRNOG00000007422
UniProt: D3ZYG0
Position
3
AA seq 868 aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMKMGLTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRQVLSPVDMATIFINLE
DLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSALNQLLASRD
DFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQ
GYLCTRCGVGAHKECLEVIPPCKMSSPADADAPGAGLGPKMVAVQNYHGNPAPPGKPVLT
FQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVGRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIH
ITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERAATRASSRSPASCASYSF
SFLSPQGLSFAPQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIG
GDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggagcagtggcggcaatgcggccgctggctcattgactgcaaggtcctgccgcccaac
caccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggc
gtccttctgtgccagctgctgcacaacctctcccccggctccatcgaccttaaggacatc
aacttccggccgcagatgtcccagttcctgtgtctgaagaatattcgcaccttcctcaaa
gtctgccacgacaaatttggactaaggaacagtgagctgtttgaccctttcgacctcttt
gatgtccgagacttcgggaaggtcatctctgccgtgtcccgtctgtccctgcacagcatc
gcgcagagcaaagggatcaggccttttccatcagaggagacggctgaaaacgatgacgat
gtctaccggagtctggaagagctggctgacgagcatgacctgggtgaggacatctacgac
tgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtg
cagcagcccatgaaaatgggactaaccgaggacgacaagaggagctgctgcttgttagag
attcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatg
ggtcccttgcggcaggtgctgagccccgtggacatggccaccatcttcatcaacctggag
gacctcatcaaggtgcaccacagctttctgcgagccatcgatgtgtccatgatggctggt
ggcagtaccctggctaaggtcttcctggagtttaaggaacggctcctgatctacggagag
tactgtagccacatggagcatgcgcagagcgcactgaaccagctcctcgccagccgagac
gacttcaggcagaaagtggaggagtgcacactcaaggtccaggagggcaagttcaagctg
caggatctgctggtggtgcccatgcagcgggtgctcaagtaccacctgttgctcaaggag
ctcctgagccattccgcagaccggcctgaaagacaacagctcaaagaagcactggaagcc
atgcaggacttggccatgtatattaatgaagtgaaacgggacaaggagaccttgaagaag
attagtgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggagg
ccgaagattgacggggagctgaaagttcggtccatagtcaaccacaccaagcaagacagg
tacctgttcctgtttgacaaggtggtcatcgtgtgtaagaggaagggctacagctatgag
ctgaaggaggttattgaactgctcttccacaagatgactgatgaccccatgcacaacaaa
gacatcaagaagtggtcctatggcttctacctgattcacctccaagggaagcaaggcttt
cagttcttctgcaagacggaagacatgaaacggaagtggatggagcagttcgagatggcc
atgtcaaacatcaagccagacaaggccaatgccaaccatcatagtttccagatgtacacg
tttgacaagaccaccaactgcaaagcctgcaagatgttcctcaggggtaccttctaccag
ggatacctgtgtaccagatgtggtgtcggggcacacaaggagtgcctggaggtgataccc
ccctgcaagatgagttcgcctgcagatgcggacgctcccggagcaggactaggtcccaag
atggttgccgtgcagaattaccatggtaacccagcccctcccgggaagcccgtgttgacc
ttccagacaggggatgtgatagagctgctccggggtgaccccgattctccttggtgggag
gggaggctggttcaaactcggaagtcagggtatttccccagctcatctgtgaagccctgc
ccggtggacggaaggccgcctgttggccgcccgccatcccgggagatcgattacactgca
tacccgtggttcgctggcaacatggaacggcagcagacggacaatctactcaagtctcat
gccagcgggacctacctcatcagagagcgcccagcagaggcagagcgtttcgccatcagc
atcaagttcaatgatgaagtgaaacacatcaaggtggtggaaaaagacagctggatccac
atcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgccac
tcacttaaggagagcttcaagcagttagacactacactcaagttcccctacaagtctcgg
gagcgcgccgccaccagggcctcaagccgatctccagcttcgtgtgcttcctacagcttt
tcttttctcagtcctcagggcctcagctttgccccccagggcccctctgctcccttctgg
tcagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgcacga
gacatgcgggagctgtcgctgcgggaaggtgatgtggtgaagatctacagccggatcggt
ggggaccagggctggtggaagggcgagacgaacgggcggatcggttggtttccttcgacg
tacgtggaagaggaaggcatccagtga

DBGET integrated database retrieval system