KEGG   Rattus norvegicus (rat): 25157Help
Entry
25157             CDS       T01003                                 

Gene name
Plagl1, Lot1, Zac1
Definition
(RefSeq) PLAG1 like zinc finger 1
  KO
K19485  zinc finger protein PLAGL1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25157 (Plagl1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    25157 (Plagl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-H2C2_2 RNA_pol_Rpc4 zf-C2H2_6 DNA_pol_phi Tim54 zf-met
Motif
Other DBs
NCBI-GeneID: 25157
NCBI-ProteinID: NP_036892
RGD: 3014
Ensembl: ENSRNOG00000025587
UniProt: P70616
Position
1p13
AA seq 583 aa AA seqDB search
MAPFRCQKCGKSFLTLEKFTIHNYSHTRERPFKCSKTECGKAFVSKYKLMRHMATHSPQK
THQCTHCEKTFNRKDHLKNHLQTHDPNKMIYACEDCGKKYHTMLGYKRHMALHSASSGDL
TCGVCTLELGSTEVLLDHLKSHAEEKAHHAPREKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMQESLQAGEYQGGYQPIAPPFQIKADPMP
PFQLEMPPESGLDGGLPPEIHGLVLASPEEVPQPMLSMPPMQPMPEQPFTLHPGVVPSSP
PPIILQEHKYSPVPTSFAPFVSMPMKADLKGFCNMGLFEEFPLQECQSPVKFSQCFEMAK
EGFGKVTLPKELLVDAVNIAIPGSLEISSLLGFWQLPPPPPQNGFMNGTIPVGAGEPLPH
RITCLAQQQPPPLLPPPPPLPLPEPLPQPQLPPQFQLQLQPQPQMQPQMQLQPLQLQLPQ
LLPQLQPEPEPEPEPEEEEEEEEEIEEEEEIEEEEEAEPEAEEEEEAEDEEEAEEEEEEP
QPEEAQIAMSAVNMGQPPLPPTPHVFTAGTNTAILPHFHHAFR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggctccttttcgctgtcaaaaatgcggcaagtccttcctcaccctggagaagttcacc
atccacaattattcccacaccagggagcgcccattcaagtgctccaagactgagtgtggc
aaagccttcgtctccaagtataagctgatgagacacatggctacgcactctccccagaag
acgcaccagtgcactcattgtgaaaagactttcaaccggaaggatcatctgaagaatcac
ctccagacccacgatcccaacaagatgatctacgcctgcgaagattgtggcaagaaatac
cacaccatgctgggctacaagaggcacatggccctgcattcggccagcagcggcgatctc
acctgcggcgtctgcaccctggagctggggagcaccgaggtcctgctggaccacctcaag
tctcacgcggaagaaaaggcccaccacgcgcccagggagaagaaacaccagtgcgaccac
tgcgagagatgcttctacacccggaaggatgtgcgtcgccacctggtggtccacacagga
tgcaaggacttcctgtgtcagttctgcgcccagagatttgggcgcaaagaccacctcact
cgtcacaccaagaagacccactcccaggagctgatgcaagagagcctgcaagcaggagaa
taccagggcggttaccaacccattgcgcctccgttccagatcaaggctgatcccatgcct
cctttccagttagaaatgccccccgagagcgggcttgatgggggcttgcctcctgagatt
catggtctagtgcttgcttccccagaggaggttccccagcctatgctgtctatgccgcca
atgcagccaatgccagagcagcctttcactctgcaccctggggtagttccctcctctcct
cccccgatcattcttcaggagcataagtacagcccagttcctacctcttttgccccgttc
gtaagcatgccgatgaaagcagatctcaagggcttttgcaacatgggtctctttgaggaa
tttcctctgcaagagtgtcagtcgcctgtcaagttcagtcagtgctttgagatggctaag
gaagggtttgggaaagtcaccctgcccaaagagctgctggtagatgctgtaaatatagcc
attcctggctctctggagatttcctctctcttggggttctggcagctgccccctcctcct
ccccagaatggcttcatgaatggcaccatccctgtgggggccggggagccgctgccccat
aggataacttgtctggcacagcagcagccaccacctctgctacctccgccgccgccgctg
ccgctgccagagccgctgccacagccacagctgccgccacagtttcagttgcagctccag
ccccagccccagatgcagccccagatgcagctgcagcctctacagctgcagctgccccag
ctgctgccccagctgcagcccgagcctgagccagagccagagccagaggaagaagaggaa
gaagaagaagagatagaagaagaagaagagatcgaagaagaagaagaagccgaaccagaa
gcagaagaagaagaggaggcagaagacgaagaggaggcagaggaagaggaagaagagcca
cagccagaagaagcccaaatagcaatgagcgctgtgaatatgggccagcccccgctaccc
ccgacccctcatgttttcacagctggcaccaacactgctatcctgccccatttccaccac
gcgttcagataa

DBGET integrated database retrieval system