KEGG   Rattus norvegicus (rat): 25159
Entry
25159             CDS       T01003                                 

Gene name
Gata2
Definition
(RefSeq) GATA binding protein 2
  KO
K17894  GATA-binding protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25159 (Gata2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    25159 (Gata2)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon
Other DBs
NCBI-GeneID: 25159
NCBI-ProteinID: NP_254277
RGD: 2664
Ensembl: ENSRNOG00000012347
UniProt: Q924Y4 B2DBE1
Position
4q34
AA seq 480 aa
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHSPWTVSP
FSKTPLHPSAAGAPGGPLSVYPGAAGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPASPSAGGSVARGEDKDGVKYQVSLSESMKMEGGSPLRPGLAPMGTQP
ATHHPIPTYPSYVPASAHEYGSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSSKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggaggtggcgcctgagcagcctcgctggatggcgcaccccgccgtattgaatgcgcag
caccccgactcgcaccatccgggcctggcacacaactacatggagccggcacagctgctg
cctccggacgaggtggatgtcttcttcaaccacctcgactcgcagggcaacccctactac
gccaacccagcccacgcgcgcgcgcgcgtttcctacagtccagcgcatgcccgtctcaca
ggaggccagatgtgccgaccacacttgttgcacagcccaggcttgccatggctggacggg
ggcaaagcagctctctctgccgctgctgcccatcaccacagcccctggaccgtcagcccg
ttctccaagaccccgctgcacccctcagctgctggagcacctggagggcctctgtctgtg
tacccaggggctgcgggtgggagcggtggaggcagcgggagctccgtagcctccctcacc
cccactgcagcccactcaggctcccatctcttcggcttcccacccacgccacccaaagaa
gtgtctccagaccccagcaccacaggagctgcttccccagcctcaccttcagcagggggt
agtgtagcccggggtgaggacaaggatggcgtcaagtatcaagtgtcactgtctgagagc
atgaagatggaaggtggcagtcccctgcgcccgggcctagctcccatgggcacccagcct
gcaacacaccacccaatacccacctatccctcctatgtgcctgcctcagctcatgaatat
ggcagcgggctcttccatcccggaggcttcctgggtggcccagcctccagcttcacccct
aagcagcgaagcaaggctcgctcctgctcagaaggccgggagtgtgtcaactgcggggcc
acagccacccctctctggcgacgggatggcacgggccactacctgtgcaatgcctgtggg
ctctaccacaagatgaatggacagaatcggccgctcatcaagcccaagaggagactgtct
gctgccaggagagcgggcacctgttgtgcaaattgtcagacgacaaccaccaccttatgg
cgccggaacgccaacggggaccctgtgtgcaacgcctgtggcctctactacaagctgcac
aatgttaacaggccactgaccatgaagaaggaagggatccagacccggaatcggaagatg
tccagcaaatccaagaagagcaagaaaggagccgaatgctttgaggagctatccaagtgc
atgcaggagaagtcatcccccttcagtgcggctgccctggctggacacatggcacctgtg
ggacacctcccaccttttagtcactctggacacatcctacctacgccaacgcctatccac
ccctcctccagtctctcctttggtcacccccacccgtccagcatggtgactgccatgggc
tag

DBGET integrated database retrieval system