KEGG   Rattus norvegicus (rat): 25166
Entry
25166             CDS       T01003                                 

Gene name
Casp1
Definition
(RefSeq) caspase-1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05135  Yersinia infection
rno05164  Influenza A
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25166 (Casp1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    25166 (Casp1)
   04621 NOD-like receptor signaling pathway
    25166 (Casp1)
   04623 Cytosolic DNA-sensing pathway
    25166 (Casp1)
   04625 C-type lectin receptor signaling pathway
    25166 (Casp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    25166 (Casp1)
   05164 Influenza A
    25166 (Casp1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    25166 (Casp1)
   05135 Yersinia infection
    25166 (Casp1)
   05133 Pertussis
    25166 (Casp1)
   05134 Legionellosis
    25166 (Casp1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    25166 (Casp1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25166 (Casp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25166 (Casp1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25166 (Casp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     25166 (Casp1)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C14: caspase family
   25166 (Casp1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    25166 (Casp1)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 25166
NCBI-ProteinID: NP_036894
RGD: 2274
Ensembl: ENSRNOG00000007372
UniProt: Q91W32
Position
8
AA seq 402 aa
MADKILRAKRKQFINSVSVGTINGLLDELLEKRVLNQEEMDTIKLANITVMEKARDLCDH
VTKKGPRASQMFITYICNEDCYLAEILELQSGPSAETVFVTEDSKGGHPFSSETKEKLNK
EGGAFPGPSGSLKFCPLEIAQKLWKENHSEIYPIMKTPTRTRLALIICNTDFQHLSRRVG
ADVDLREMKLLLQDLGYTVKVKENLTALEMTKELKEFAACPEHKTSDSTFLVFMSHGLQE
GICGITYSNEVADILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGN
SEEGFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVQGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPDSRLQMPTTERVTLTKRFYLFPGH
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggctgacaagatcctgagggcaaagaggaagcaatttatcaactcagtgagtgtaggg
acaataaatggattgctggatgaacttttagagaagagagtcctgaaccaggaagagatg
gatacaatcaaacttgcaaatatcactgttatggaaaaggcacgagacctgtgcgatcat
gtcactaaaaaaggaccccgggcaagccagatgtttatcacttacatttgtaatgaagac
tgctacctggcagaaattctggagcttcagtcaggtccatcagctgaaactgtttttgtt
acagaagattctaagggaggacatcctttctcctcagaaacaaaagaaaaactgaacaaa
gaaggtggcgcatttcctggaccgagtggttccctcaagttttgccctttagaaatagcc
cagaagttatggaaagaaaatcattcagagatttatccaataatgaaaacacccactcgt
acacgtcttgccctcattatctgcaacacagactttcaacatctttctcggagagtcgga
gctgatgttgacctcagagaaatgaagttgctgctgcaggatctggggtatactgtgaaa
gtcaaagaaaatctcacagctctggagatgacaaaagaattgaaagaatttgctgcctgc
ccagagcacaagacttctgacagtaccttccttgtattcatgtctcatggtctccaggag
ggaatatgtgggatcacatactctaatgaagttgcagatattttaaaggttgacacaatc
tttcaaatgatgaacacattgaagtgcccaagcttgaaagacaagcccaaggttatcatt
attcaggcatgccgtggagagaaacaaggagtggtgttgttaaaagattcagtagggaac
tccgaagagggattcttaacagatgcaatttttgaagatgatggcattaagaaggcccat
atagagaaagattttattgctttctgctcttcaacaccagataatgtgtcctggagacat
cctgtccagggatctctcttcattgagtcactcatcaaacacatgaaagaatatgcctgg
tcttgtgacttggaggacattttcagaaaggttcgattttctttcgaacaaccagactct
agactacagatgccaaccactgaaagggtgaccctgacaaaacgtttctacctcttccca
ggacattaa

DBGET integrated database retrieval system