KEGG   Rattus norvegicus (rat): 25172
Entry
25172             CDS       T01003                                 

Gene name
Gata1, Eryf1
Definition
(RefSeq) GATA binding protein 1
  KO
K09182  GATA-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25172 (Gata1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    25172 (Gata1)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon Zn-ribbon_8 ArfGap
Other DBs
NCBI-GeneID: 25172
NCBI-ProteinID: NP_036896
RGD: 2663
Ensembl: ENSRNOG00000047663
UniProt: P43429
Position
Xq12
AA seq 413 aa
MDFPGLGALGTSEPLPQFVDSALVSSTSDSAGFFSSGPESLDTASSSTSPNAATAAATAL
AYYREAEAYRHSPVFQVYPLLNSMEGIPGSSPYASWAYSKTALYPASTVCPSHEDAPSQT
LEDPDGKNNNTFLETLKTERLSPDLLTLGTALPTSLPVTSSAYGGADFPSPFFSPTGSPL
SSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLAGAGAAEGPAGGFMVVAGGSSSGNCGEVAPGLTLGTAGT
AHLYQGLGPVVLSGPVSHLMSFPGPLLGSPTASFPTGPVPTTTSTSVVSPLSS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggattttcctggtctaggggccctgggaacctcagaacccttgccccagtttgtggat
tctgccctggtgtcctcgacatcagactcagcgggtttcttttcctctgggcctgagagt
ttggatacagcatcttcctccacttctccaaatgcagccacggcagcagccacggcactg
gcctactacagagaagctgaggcctacagacactccccagtctttcaggtgtacccgctg
ctcaacagtatggagggaatcccagggagctcaccttatgctagctgggcctatagcaag
acggcgctctaccctgcctcaactgtatgtcccagtcatgaggatgccccttcccagacc
ctggaagacccagatgggaagaacaacaatacattcttggaaaccttgaagacggagcgg
ctgagtccagacctcctgaccctggggactgcactgcctacatcactccctgtcaccagc
agtgcttatgggggagctgactttcccagtcctttcttctctcccactgggagccctctc
agctcagcagcctattcttcccccaagtttcatggaagcctaccattggctccttgtgag
gccagagagtgtgtgaactgtggagcaacggctactccactgtggcggagggacaggaca
ggtcactacctgtgcaatgcttgtggcttgtatcacaagatgaatggtcagaaccggcct
ctcatccggcccaagaagcgaatgattgtcagcaagcgagcaggcacccaatgcactaac
tgtcaaacaacaaccacgaccctctggcggaggaatgccagtggagacccggtgtgcaat
gcctgcggcctctactacaagctgcaccaggtgaaccgcccactgaccatgaggaaagat
ggaatccagacgaggaaccgcaaggcatctggaaaagggaaaaagaagcggggctcaagt
ctggccggagcaggagcggctgaaggaccagctggtggattcatggtggtagctggtggc
agcagtagtgggaattgcggagaggtggccccaggcttgacactgggcactgcaggtact
gcccatctctaccagggcctgggacctgtggtgctgtcagggcctgtcagccatcttatg
tctttccctggacctctgctgggatcgcctacggcctccttccccacaggtcctgtgcct
accaccaccagcactagcgtagtgtctccactcagttcttga

DBGET integrated database retrieval system