KEGG   Rattus norvegicus (rat): 25176
Entry
25176             CDS       T01003                                 

Gene name
Slc25a5
Definition
(RefSeq) ADP/ATP translocase 2
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25176 (Slc25a5)
   04022 cGMP-PKG signaling pathway
    25176 (Slc25a5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25176 (Slc25a5)
   04218 Cellular senescence
    25176 (Slc25a5)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    25176 (Slc25a5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25176 (Slc25a5)
   05164 Influenza A
    25176 (Slc25a5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25176 (Slc25a5)
   05012 Parkinson disease
    25176 (Slc25a5)
   05016 Huntington disease
    25176 (Slc25a5)
   05017 Spinocerebellar ataxia
    25176 (Slc25a5)
   05020 Prion disease
    25176 (Slc25a5)
   05022 Pathways of neurodegeneration - multiple diseases
    25176 (Slc25a5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25176 (Slc25a5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    25176 (Slc25a5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25176 (Slc25a5)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    25176 (Slc25a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   25176 (Slc25a5)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 25176
NCBI-ProteinID: NP_476443
RGD: 620353
Ensembl: ENSRNOG00000039980
Vega: OTTRNOG00000002010
UniProt: Q09073
Position
X
AA seq 298 aa
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggacttcttggctggtggagtggccgcggcc
atctccaagacggcggtagcacccatcgagcgggtcaagctgctgctgcaggtgcagcac
gccagcaagcaaatcacggcagataagcaatacaagggcatcatagactgcgtggttcgt
atccccaaggaacagggagtcctgtccttctggcgtggcaacctggccaatgtcatcaga
tacttccccacccaggctctcaacttcgccttcaaagataaatacaagcagatctttttg
ggtggtgtggacaagaggacccagttttggcggtactttgcagggaacctggcatcaggt
ggtgctgctggggccacatccttgtgctttgtgtaccctcttgattttgcccgtacccgt
ctagcagctgatgtgggcaaagctggagctgaaagggaattcaaaggccttggtgactgc
ctggttaagatctacaaatctgatgggattaagggcctgtaccaaggctttaatgtgtca
gtgcagggcattatcatctaccgtgctgcctacttcggtatctatgacactgcaaaggga
atgctcccggatcccaagaatactcacatcttcatcagctggatgattgcacagtctgtc
actgctgttgctggcctaacttcttatccttttgacacggttcgccgtcgtatgatgatg
cagtctggacgcaaaggaactgatatcatgtatacaggcacgcttgactgctggcggaag
atcgctcgagacgaaggaggcaaggcctttttcaagggtgcatggtccaacgttctcaga
ggcatgggtggtgcctttgtgcttgtcttgtatgatgaaatcaagaagtacacataa

KEGG   Rattus norvegicus (rat): 282819
Entry
282819            CDS       T01003                                 

Gene name
Ppif
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase F, mitochondrial precursor
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04613  Neutrophil extracellular trap formation
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05145  Toxoplasmosis
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    282819 (Ppif)
   04022 cGMP-PKG signaling pathway
    282819 (Ppif)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    282819 (Ppif)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    282819 (Ppif)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    282819 (Ppif)
   05012 Parkinson disease
    282819 (Ppif)
   05016 Huntington disease
    282819 (Ppif)
   05017 Spinocerebellar ataxia
    282819 (Ppif)
   05020 Prion disease
    282819 (Ppif)
   05022 Pathways of neurodegeneration - multiple diseases
    282819 (Ppif)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    282819 (Ppif)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    282819 (Ppif)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     282819 (Ppif)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    282819 (Ppif)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 282819
NCBI-ProteinID: NP_758443
RGD: 628670
Ensembl: ENSRNOG00000010558
UniProt: P29117
Structure
PDB: 
4TOT

Position
16
AA seq 206 aa
MLALRCGPRLLGLLSGPRSAPLLLSTTRTCSDGGARGANSSSQNPLVYLDVGADGQPLGR
VVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIY
GSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVV
KKIESFGSKSGKTSKKIVITDCGQLS
NT seq 621 nt   +upstreamnt  +downstreamnt
atgctagctctgcgctgcggtccccgcctgctcggtctgctctccggcccgcgctccgcg
ccgctcctcctctccacgacccgtacctgcagcgacggcggagcccgaggcgcgaactct
tcctcccaaaacccgctcgtgtacttggacgtgggcgccgacggacagccgctcggccgc
gtggtgctggagttaaaggcagatgtcgtgccaaagacagcagagaacttcagagccctg
tgcactggtgagaagggctttggctacaaaggctccaccttccacagggtcatcccagcc
ttcatgtgccaggctggcgacttcaccaatcacaatggcacgggagggaagtccatctac
ggaagccgctttcctgacgagaacttcacactgaagcacgtgggaccaggtgtcctgtcc
atggcaaacgcaggccccaacaccaatggctctcagttctttatctgcacaataaagaca
gactggctggatggcaagcatgttgtgtttggccatgtcaaagagggcatggatgttgtg
aagaaaatagaatctttcggctcaaaaagtgggaagacatctaagaagattgtcatcaca
gactgtggccagttgagctaa

KEGG   Rattus norvegicus (rat): 689108
Entry
689108            CDS       T01003                                 

Gene name
Slc25a31
Definition
(RefSeq) ADP/ATP translocase 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    689108 (Slc25a31)
   04022 cGMP-PKG signaling pathway
    689108 (Slc25a31)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    689108 (Slc25a31)
   04218 Cellular senescence
    689108 (Slc25a31)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    689108 (Slc25a31)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    689108 (Slc25a31)
   05164 Influenza A
    689108 (Slc25a31)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    689108 (Slc25a31)
   05012 Parkinson disease
    689108 (Slc25a31)
   05016 Huntington disease
    689108 (Slc25a31)
   05017 Spinocerebellar ataxia
    689108 (Slc25a31)
   05020 Prion disease
    689108 (Slc25a31)
   05022 Pathways of neurodegeneration - multiple diseases
    689108 (Slc25a31)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    689108 (Slc25a31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    689108 (Slc25a31)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    689108 (Slc25a31)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    689108 (Slc25a31)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   689108 (Slc25a31)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 689108
NCBI-ProteinID: XP_038959558
RGD: 1596195
Ensembl: ENSRNOG00000038398
Position
2
AA seq 320 aa
MSNNSSKKQSSKKTLFDPVSFAKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISP
EARYKGMIDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEK
QFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEQRQFTGLGDCIMKIAKS
DGLIGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLISFIIAQIVTTGSGIL
SYPFDTVRRRMMMQSGESERQYKGTIDCFLKIYNHEGMAAFFRGAFSNILRGTGGALVLV
LYDKIKELLNIDVGGSSSGD
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtcgaacaattcctccaagaagcagtcttcaaagaagacgttgttcgaccccgtgtct
ttcgcaaaggacctgctggccggcggggtcgcggccgcggtgtcgaagacagctgtggca
cccatcgagcgagtgaagctgctgttgcaggtgcaggcgtcctccaagcagataagccct
gaggcacgctacaagggcatgatagactgcctggtgcgcatccctcgtgagcaaggattt
ttaagttattggcgtggcaatttggcaaatgttattcgatactttccaacacaagcctta
aacttcgcctttaaggacaaatacaaacaacttttcatgtctggtgttaataaagaaaaa
cagttctggaggtggtttctagcaaacctggcttctggaggggctgctggagcaacatcc
ttgtgtgtggtatatccactagattttgccagaacccgattaggtgttgatattggaaaa
ggtcctgagcaacggcagttcacgggtttgggtgactgcattatgaaaatagccaagtca
gatggacttattggtctataccaagggtttggtgtctccgttcagggtatcattgtttac
cgagcctcttattttggagcttatgacactgttaagggcttattgccaaagccaaaggaa
accccatttcttatctcttttatcattgctcaaatcgtgacgactggctctggaatactc
tcctatccctttgacacagttagaagacgtatgatgatgcagagtggggaatctgaacgg
caatataaaggaaccatagactgctttctgaaaatatacaatcatgaagggatggctgca
ttcttccgtggtgccttctccaacatccttcgtggtacagggggtgctttggtcttggtg
ttatatgataaaatcaaagagctcctcaacattgatgttggaggtagttcatcaggagat
taa

KEGG   Rattus norvegicus (rat): 83529
Entry
83529             CDS       T01003                                 

Gene name
Vdac1
Definition
(RefSeq) voltage-dependent anion-selective channel protein 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04979  Cholesterol metabolism
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    83529 (Vdac1)
   04022 cGMP-PKG signaling pathway
    83529 (Vdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    83529 (Vdac1)
   04218 Cellular senescence
    83529 (Vdac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    83529 (Vdac1)
   04621 NOD-like receptor signaling pathway
    83529 (Vdac1)
  09154 Digestive system
   04979 Cholesterol metabolism
    83529 (Vdac1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    83529 (Vdac1)
   05164 Influenza A
    83529 (Vdac1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83529 (Vdac1)
   05012 Parkinson disease
    83529 (Vdac1)
   05014 Amyotrophic lateral sclerosis
    83529 (Vdac1)
   05016 Huntington disease
    83529 (Vdac1)
   05017 Spinocerebellar ataxia
    83529 (Vdac1)
   05020 Prion disease
    83529 (Vdac1)
   05022 Pathways of neurodegeneration - multiple diseases
    83529 (Vdac1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    83529 (Vdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    83529 (Vdac1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    83529 (Vdac1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    83529 (Vdac1)
Ion channels [BR:rno04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   83529 (Vdac1)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 83529
NCBI-ProteinID: NP_112643
RGD: 621575
Ensembl: ENSRNOG00000006375
UniProt: Q9Z2L0
Position
10
AA seq 283 aa
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt   +upstreamnt  +downstreamnt
atggctgtgcctcccacatatgctgatcttggcaagtccgccagggatgtcttcaccaag
ggctacggctttggcttaataaaacttgatttgaaaacgaagtccgagaatggattggaa
tttactagctcaggttctgccaacacggagaccaccaaagtgaacggcagtctggaaacc
aagtacagatggaccgagtatgggctgacgtttactgagaagtggaacacagacaacacc
ctgggcactgagatcaccgtggaagaccagcttgctcgtggactgaagctgacctttgat
tcatctttctcgcctaacactgggaaaaaaaatgctaaaatcaagacagggtacaagagg
gagcatatcaacctgggctgtgatgtggactttgacatcgctgggccctcaatccggggc
gctctggtgcttggctatgagggttggctggctggctaccagatgaattttgagacctcg
aagtcccgagtgacccagagcaactttgcagttggctacaagacggacgaattccagctt
catactaatgtgaatgatgggacggagtttggtggctccatttaccagaaggtgaacaag
aagttggagactgctgtcaatctcgcctggaccgcaggaaacagtaacactcgctttgga
atagcagccaagtatcaggtcgaccctgatgcctgcttttcggccaaagtgaacaactcc
agtctaattggcttagggtacactcagaccctaaaaccaggtatcaaactgacactgtca
gccctgctggatggcaagaacgtcaatgcgggtggccacaagcttggtttaggactggaa
tttcaagcataa

KEGG   Rattus norvegicus (rat): 83531
Entry
83531             CDS       T01003                                 

Gene name
Vdac2
Definition
(RefSeq) voltage-dependent anion-selective channel protein 2
  KO
K15040  voltage-dependent anion channel protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04216  Ferroptosis
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04979  Cholesterol metabolism
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    83531 (Vdac2)
   04022 cGMP-PKG signaling pathway
    83531 (Vdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    83531 (Vdac2)
   04217 Necroptosis
    83531 (Vdac2)
   04218 Cellular senescence
    83531 (Vdac2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    83531 (Vdac2)
   04621 NOD-like receptor signaling pathway
    83531 (Vdac2)
  09154 Digestive system
   04979 Cholesterol metabolism
    83531 (Vdac2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    83531 (Vdac2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83531 (Vdac2)
   05012 Parkinson disease
    83531 (Vdac2)
   05016 Huntington disease
    83531 (Vdac2)
   05017 Spinocerebellar ataxia
    83531 (Vdac2)
   05020 Prion disease
    83531 (Vdac2)
   05022 Pathways of neurodegeneration - multiple diseases
    83531 (Vdac2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    83531 (Vdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    83531 (Vdac2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    83531 (Vdac2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    83531 (Vdac2)
Ion channels [BR:rno04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   83531 (Vdac2)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 83531
NCBI-ProteinID: NP_112644
RGD: 621576
Ensembl: ENSRNOG00000013505
UniProt: P81155
Position
15
AA seq 295 aa
MAECCVPVCQRPICIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSN
TDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTG
KKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSN
FAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLD
PTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA
NT seq 888 nt   +upstreamnt  +downstreamnt
atggctgaatgttgtgtaccggtatgccaacggccaatttgtatccctccaccctatgct
gaccttggcaaagctgccagagatattttcaacaaaggatttggttttgggttggtaaag
ctggatgtgaaaacgaagtcatgcagtggtgtggaattttcaacatctggctcatctaat
acagacactggtaaagtcagtgggaccttggagaccaagtacaaatggtgtgagtatggt
ctgactttcacagagaaatggaacactgacaacactctggggacggagattgcaattgaa
gaccagatttgtcaaggtttgaaactgacctttgacaccacgttttcaccaaacacagga
aagaaaagtggtaaaatcaagtctgcttacaagagggaatgtataaaccttggctgtgat
gttgattttgattttgctggacctgccatccatgggtcagccgtctttggttacgagggc
tggcttgctgggtaccagatgacctttgacagtgccaagtcaaagctgacaaggagtaac
ttcgcagttggctacaggactggggacttccagctacacacaaatgtaaataatgggaca
gaatttggaggatcaatttatcagaaagtatgtgaagattttgacacttcagtaaacctt
gcttggacatcaggtaccaactgcactcgttttggcattgcagctaaataccagttggac
cccactgcttctatttctgcaaaggtcaacaactctagtttaattggagtgggctatact
cagactctgaggcctggtgtgaagcttacactgtctgctctggtagacgggaagagcttt
aatgctggaggccacaaacttgggcttgccttggaattggaggcttaa

KEGG   Rattus norvegicus (rat): 83532
Entry
83532             CDS       T01003                                 

Gene name
Vdac3
Definition
(RefSeq) voltage-dependent anion-selective channel protein 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04216  Ferroptosis
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04979  Cholesterol metabolism
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    83532 (Vdac3)
   04022 cGMP-PKG signaling pathway
    83532 (Vdac3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    83532 (Vdac3)
   04217 Necroptosis
    83532 (Vdac3)
   04218 Cellular senescence
    83532 (Vdac3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    83532 (Vdac3)
   04621 NOD-like receptor signaling pathway
    83532 (Vdac3)
  09154 Digestive system
   04979 Cholesterol metabolism
    83532 (Vdac3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    83532 (Vdac3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    83532 (Vdac3)
   05161 Hepatitis B
    83532 (Vdac3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83532 (Vdac3)
   05012 Parkinson disease
    83532 (Vdac3)
   05016 Huntington disease
    83532 (Vdac3)
   05017 Spinocerebellar ataxia
    83532 (Vdac3)
   05020 Prion disease
    83532 (Vdac3)
   05022 Pathways of neurodegeneration - multiple diseases
    83532 (Vdac3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    83532 (Vdac3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    83532 (Vdac3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    83532 (Vdac3)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    83532 (Vdac3)
Ion channels [BR:rno04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   83532 (Vdac3)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 83532
NCBI-ProteinID: NP_112645
RGD: 621577
Ensembl: ENSRNOG00000019277
UniProt: Q9R1Z0
Position
16
AA seq 283 aa
MCSTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLIFTQKWNTDNTLGTEISWENKLAEGLKLTVDTIFVPNTGKKSGKLKASYRR
DCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLCQNNFALGYKAEDFQL
HTHVNDGTEFGGSIYQRVNEKIETSINLAWTAGSNNTRFGIAAKYRLDCRTSLSAKVNNA
SLIGLGYTQSLRPGVKLTLSALVDGKNFNAGGHKVGLGFELEA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtgtagcacaccaacttactgcgacctaggaaaggctgccaaggatgtctttaacaaa
gggtatgggtttggcatggtcaaaatagatctgaaaaccaagtcttgtagtggagtggaa
ttttctacttctggtcatgcttatactgatacagggaaagcatcaggcaacctagagacc
aaatataaggtctgtaactacgggctcatcttcacccaaaagtggaatacagacaatact
cttgggacagaaatctcttgggagaataagttggctgaagggttgaaactgacggttgat
accatatttgtaccaaacacagggaagaagagtgggaaattaaaggcctcctatagacgg
gattgttttagtgtgggcagtaacgttgacatagatttttctggaccgaccatctatggc
tgggccgtgttggcctttgaaggttggcttgctggctaccagatgagttttgacacagcc
aaatccaaactgtgtcagaataattttgctcttggttacaaggctgaagacttccaactg
catactcatgtaaacgatggcactgaatttggaggctccatctaccagagagttaatgag
aagatcgaaacatcaataaacctggcatggacagctggcagcaacaacactcgttttggc
atcgctgctaagtataggctggattgtagaacttctctgtctgccaaagtaaacaatgcc
agtttaattggactgggttatacgcagagtctccgaccgggagtcaaactgaccctgtca
gctttagtggatggaaagaacttcaatgcaggaggccacaaggttggcttgggatttgaa
ctggaagcttaa

KEGG   Rattus norvegicus (rat): 85333
Entry
85333             CDS       T01003                                 

Gene name
Slc25a4
Definition
(RefSeq) ADP/ATP translocase 1
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    85333 (Slc25a4)
   04022 cGMP-PKG signaling pathway
    85333 (Slc25a4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    85333 (Slc25a4)
   04218 Cellular senescence
    85333 (Slc25a4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    85333 (Slc25a4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    85333 (Slc25a4)
   05164 Influenza A
    85333 (Slc25a4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    85333 (Slc25a4)
   05012 Parkinson disease
    85333 (Slc25a4)
   05016 Huntington disease
    85333 (Slc25a4)
   05017 Spinocerebellar ataxia
    85333 (Slc25a4)
   05020 Prion disease
    85333 (Slc25a4)
   05022 Pathways of neurodegeneration - multiple diseases
    85333 (Slc25a4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    85333 (Slc25a4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    85333 (Slc25a4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    85333 (Slc25a4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    85333 (Slc25a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   85333 (Slc25a4)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 85333
NCBI-ProteinID: NP_445967
RGD: 620352
Ensembl: ENSRNOG00000010830
UniProt: Q05962 Q6P9Y4
Position
16
AA seq 298 aa
MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgggggatcaggctttgagcttccttaaggacttcctggcaggtggcatcgccgccgcc
gtctccaagaccgcggtcgccccgatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgcagagaaacagtacaaaggcatcattgattgtgtcgtgaga
atccccaaggagcagggctttctctccttctggaggggtaacctggccaacgtgatccgg
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagatcttcctg
ggaggtgtggatcgtcataagcagttctggcgctacttcgctggtaacctggcctctggt
ggggcagctggggctacctccctctgcttcgtctacccactggactttgctaggaccagg
ctggctgccgacgtgggcaagggatcttcccagcgtgagttcaatgggctgggtgactgt
ctcaccaagatcttcaagtctgatggcctgaagggtctctaccagggtttcagtgtctct
gtgcagggcatcatcatctacagagctgcctacttcggagtctatgacactgccaagggg
atgctgccagaccccaagaatgtgcacattattgtgagctggatgattgcccagagtgtg
acagccgtggcggggctggtgtcctatccatttgacactgtccgtcgtaggatgatgatg
cagtctggccggaaaggggctgatattatgtacacggggacagttgactgctggaggaag
attgcaaaagatgaaggagccaaagctttcttcaaaggtgcttggtccaacgtactgaga
ggcatggggggtgcttttgtattggtattgtatgatgagatcaaaaaatatgtgtaa

DBGET integrated database retrieval system