KEGG   Rattus norvegicus (rat): 25176
Entry
25176             CDS       T01003                                 

Gene name
Slc25a5
Definition
(RefSeq) ADP/ATP translocase 2
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25176 (Slc25a5)
   04022 cGMP-PKG signaling pathway
    25176 (Slc25a5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25176 (Slc25a5)
   04218 Cellular senescence
    25176 (Slc25a5)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    25176 (Slc25a5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25176 (Slc25a5)
   05164 Influenza A
    25176 (Slc25a5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25176 (Slc25a5)
   05012 Parkinson disease
    25176 (Slc25a5)
   05016 Huntington disease
    25176 (Slc25a5)
   05017 Spinocerebellar ataxia
    25176 (Slc25a5)
   05020 Prion disease
    25176 (Slc25a5)
   05022 Pathways of neurodegeneration - multiple diseases
    25176 (Slc25a5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25176 (Slc25a5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    25176 (Slc25a5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25176 (Slc25a5)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    25176 (Slc25a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   25176 (Slc25a5)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 25176
NCBI-ProteinID: NP_476443
RGD: 620353
Ensembl: ENSRNOG00000039980
Vega: OTTRNOG00000002010
UniProt: Q09073
Position
X
AA seq 298 aa
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggacttcttggctggtggagtggccgcggcc
atctccaagacggcggtagcacccatcgagcgggtcaagctgctgctgcaggtgcagcac
gccagcaagcaaatcacggcagataagcaatacaagggcatcatagactgcgtggttcgt
atccccaaggaacagggagtcctgtccttctggcgtggcaacctggccaatgtcatcaga
tacttccccacccaggctctcaacttcgccttcaaagataaatacaagcagatctttttg
ggtggtgtggacaagaggacccagttttggcggtactttgcagggaacctggcatcaggt
ggtgctgctggggccacatccttgtgctttgtgtaccctcttgattttgcccgtacccgt
ctagcagctgatgtgggcaaagctggagctgaaagggaattcaaaggccttggtgactgc
ctggttaagatctacaaatctgatgggattaagggcctgtaccaaggctttaatgtgtca
gtgcagggcattatcatctaccgtgctgcctacttcggtatctatgacactgcaaaggga
atgctcccggatcccaagaatactcacatcttcatcagctggatgattgcacagtctgtc
actgctgttgctggcctaacttcttatccttttgacacggttcgccgtcgtatgatgatg
cagtctggacgcaaaggaactgatatcatgtatacaggcacgcttgactgctggcggaag
atcgctcgagacgaaggaggcaaggcctttttcaagggtgcatggtccaacgttctcaga
ggcatgggtggtgcctttgtgcttgtcttgtatgatgaaatcaagaagtacacataa

KEGG   Rattus norvegicus (rat): 689108
Entry
689108            CDS       T01003                                 

Gene name
Slc25a31
Definition
(RefSeq) ADP/ATP translocase 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    689108 (Slc25a31)
   04022 cGMP-PKG signaling pathway
    689108 (Slc25a31)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    689108 (Slc25a31)
   04218 Cellular senescence
    689108 (Slc25a31)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    689108 (Slc25a31)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    689108 (Slc25a31)
   05164 Influenza A
    689108 (Slc25a31)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    689108 (Slc25a31)
   05012 Parkinson disease
    689108 (Slc25a31)
   05016 Huntington disease
    689108 (Slc25a31)
   05017 Spinocerebellar ataxia
    689108 (Slc25a31)
   05020 Prion disease
    689108 (Slc25a31)
   05022 Pathways of neurodegeneration - multiple diseases
    689108 (Slc25a31)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    689108 (Slc25a31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    689108 (Slc25a31)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    689108 (Slc25a31)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    689108 (Slc25a31)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   689108 (Slc25a31)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 689108
NCBI-ProteinID: XP_038959558
RGD: 1596195
Ensembl: ENSRNOG00000038398
Position
2
AA seq 320 aa
MSNNSSKKQSSKKTLFDPVSFAKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISP
EARYKGMIDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEK
QFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEQRQFTGLGDCIMKIAKS
DGLIGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLISFIIAQIVTTGSGIL
SYPFDTVRRRMMMQSGESERQYKGTIDCFLKIYNHEGMAAFFRGAFSNILRGTGGALVLV
LYDKIKELLNIDVGGSSSGD
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtcgaacaattcctccaagaagcagtcttcaaagaagacgttgttcgaccccgtgtct
ttcgcaaaggacctgctggccggcggggtcgcggccgcggtgtcgaagacagctgtggca
cccatcgagcgagtgaagctgctgttgcaggtgcaggcgtcctccaagcagataagccct
gaggcacgctacaagggcatgatagactgcctggtgcgcatccctcgtgagcaaggattt
ttaagttattggcgtggcaatttggcaaatgttattcgatactttccaacacaagcctta
aacttcgcctttaaggacaaatacaaacaacttttcatgtctggtgttaataaagaaaaa
cagttctggaggtggtttctagcaaacctggcttctggaggggctgctggagcaacatcc
ttgtgtgtggtatatccactagattttgccagaacccgattaggtgttgatattggaaaa
ggtcctgagcaacggcagttcacgggtttgggtgactgcattatgaaaatagccaagtca
gatggacttattggtctataccaagggtttggtgtctccgttcagggtatcattgtttac
cgagcctcttattttggagcttatgacactgttaagggcttattgccaaagccaaaggaa
accccatttcttatctcttttatcattgctcaaatcgtgacgactggctctggaatactc
tcctatccctttgacacagttagaagacgtatgatgatgcagagtggggaatctgaacgg
caatataaaggaaccatagactgctttctgaaaatatacaatcatgaagggatggctgca
ttcttccgtggtgccttctccaacatccttcgtggtacagggggtgctttggtcttggtg
ttatatgataaaatcaaagagctcctcaacattgatgttggaggtagttcatcaggagat
taa

KEGG   Rattus norvegicus (rat): 85333
Entry
85333             CDS       T01003                                 

Gene name
Slc25a4
Definition
(RefSeq) ADP/ATP translocase 1
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno04613  Neutrophil extracellular trap formation
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    85333 (Slc25a4)
   04022 cGMP-PKG signaling pathway
    85333 (Slc25a4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    85333 (Slc25a4)
   04218 Cellular senescence
    85333 (Slc25a4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    85333 (Slc25a4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    85333 (Slc25a4)
   05164 Influenza A
    85333 (Slc25a4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    85333 (Slc25a4)
   05012 Parkinson disease
    85333 (Slc25a4)
   05016 Huntington disease
    85333 (Slc25a4)
   05017 Spinocerebellar ataxia
    85333 (Slc25a4)
   05020 Prion disease
    85333 (Slc25a4)
   05022 Pathways of neurodegeneration - multiple diseases
    85333 (Slc25a4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    85333 (Slc25a4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    85333 (Slc25a4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    85333 (Slc25a4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    85333 (Slc25a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   85333 (Slc25a4)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 85333
NCBI-ProteinID: NP_445967
RGD: 620352
Ensembl: ENSRNOG00000010830
UniProt: Q05962 Q6P9Y4
Position
16
AA seq 298 aa
MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgggggatcaggctttgagcttccttaaggacttcctggcaggtggcatcgccgccgcc
gtctccaagaccgcggtcgccccgatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgcagagaaacagtacaaaggcatcattgattgtgtcgtgaga
atccccaaggagcagggctttctctccttctggaggggtaacctggccaacgtgatccgg
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagatcttcctg
ggaggtgtggatcgtcataagcagttctggcgctacttcgctggtaacctggcctctggt
ggggcagctggggctacctccctctgcttcgtctacccactggactttgctaggaccagg
ctggctgccgacgtgggcaagggatcttcccagcgtgagttcaatgggctgggtgactgt
ctcaccaagatcttcaagtctgatggcctgaagggtctctaccagggtttcagtgtctct
gtgcagggcatcatcatctacagagctgcctacttcggagtctatgacactgccaagggg
atgctgccagaccccaagaatgtgcacattattgtgagctggatgattgcccagagtgtg
acagccgtggcggggctggtgtcctatccatttgacactgtccgtcgtaggatgatgatg
cagtctggccggaaaggggctgatattatgtacacggggacagttgactgctggaggaag
attgcaaaagatgaaggagccaaagctttcttcaaaggtgcttggtccaacgtactgaga
ggcatggggggtgcttttgtattggtattgtatgatgagatcaaaaaatatgtgtaa

DBGET integrated database retrieval system