KEGG   Rattus norvegicus (rat): 25183
Entry
25183             CDS       T01003                                 
Symbol
Gdi1
Name
(RefSeq) rab GDP dissociation inhibitor alpha
  KO
K17255  Rab GDP dissociation inhibitor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25183 (Gdi1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25183 (Gdi1)
SSDB
Motif
Pfam: GDI Amino_oxidase
Other DBs
NCBI-GeneID: 25183
NCBI-ProteinID: NP_058784
RGD: 2676
Ensembl: ENSRNOG00000056870
UniProt: P50398
Position
X:152087611..152094274
AA seq 447 aa
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLE
GPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP
STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRI
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETA
EPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGSAFDFENMKRKQNDVFGEADQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggatgaggaatacgatgtgattgtgctggggacaggtcttaccgaatgcatcctgtct
ggcatcatgtctgtgaatggaaagaaggtgttgcacatggaccgaaacccctactatggg
ggtgagagctcttctatcacaccccttgaggagctatataagcgctttcagttgctggaa
gggccccctgaatcaatgggccggggccgagactggaatgttgacttgatccccaaattc
ctcatggccaatggtcagctggtaaagatgctactgtatacagaagtgactcgttatctg
gacttcaaggtggtagagggcagctttgtatacaaagggggcaagatctacaaagtgcca
tctactgagactgaggccttggcttctaatctgatgggcatgtttgaaaaacgacgcttc
cgaaaatttttggtgtttgtggcaaactttgatgagaatgaccccaaaacctttgagggt
gttgacccgcagaccaccagcatgcgtgatgtctaccggaagtttgacctgggccaagat
gtcattgatttcactggccatgccctggcgctctaccgcactgatgattacctggatcag
ccatgtcttgagactattaaccgcatcaagttgtacagtgagtccctggcccggtatggc
aagagcccatatttgtacccactctatggcctgggtgagctgcctcagggctttgccaga
ttgagtgccatctatgggggaacatacatgctgaacaaaccagtggatgacatcatcatg
gaaaatggcaaggtggtgggtgtaaaatctgagggagaggtggcccgctgcaagcagctg
atctgtgatcccagctacatcccagaccgtgtgcgaaaggctggccaggttattcgcatc
atctgcatcctcagccaccccatcaagaataccaatgatgccaattcctgccaaattatc
atccctcagaatcaggtcaacaggaagtcagacatctatgtgtgcatgatctcctatgca
cacaacgtggccgcacaaggcaaatacatcgccattgccagcaccaccgtagagactgca
gaaccagaaaaggaggttgagcctgcattggagctgttggaacctattgaccaaaagttt
gtggctatcagtgatttatatgagcccattgatgacggttcagagagtcaggtgttctgt
tcctgctcctatgatgctaccacacactttgagacaacctgcaatgacatcaaagatatc
tacaaacgcatggctggttctgcctttgattttgagaacatgaagcgcaaacagaatgat
gtctttggagaagccgatcagtga

DBGET integrated database retrieval system