KEGG   Rattus norvegicus (rat): 25186Help
Entry
25186             CDS       T01003                                 

Gene name
Efnb1, LERK2
Definition
(RefSeq) ephrin B1
  KO
K05463  ephrin-B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    25186 (Efnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25186 (Efnb1)
   04052 Cytokines and growth factors [BR:rno04052]
    25186 (Efnb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   25186 (Efnb1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25186 (Efnb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin DUF4381 DUF1180 Glucos_trans_II PalH TMEM132D_C Syndecan EphA2_TM Cadherin_C_2 Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 25186
NCBI-ProteinID: NP_058785
RGD: 2540
Ensembl: ENSRNOG00000006877
Vega: OTTRNOG00000000566
UniProt: Q6P7B6
Position
Xq22
AA seq 345 aa AA seqDB search
MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPN
YMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSR
PSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDTDSFFNSKVALF
AAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSD
IIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcctgggcagcgttggctcagcaagtggcttgtggctatggtcgtgctgacg
ctgtgccggcttgccacgccgttggccaagaacctggagcccgtgtcctggagctctctt
aaccctaagttcctaagtgggaagggcttggtgatctacccgaagattggagataagctg
gacatcatctgcccccgagcagaagcaggacggccctacgagtactacaagctgtacctg
gtgcggccggagcaggcagctgcttgcagcactgtgcttgatcccaatgtactggtcact
tgcaacaagccacagcaggaaatccgctttaccatcaagttccaggagttcagccccaac
tacatgggcctggaattcaaaaagtaccatgattactacattacatcaacatccaatggg
agcttggaagggctggagaaccgagagggaggtgtgtgccgtacacgcactatgaagatt
gttatgaaggttgggcaagatccaaatgccgtaacgcctgagcagttgactaccagccgg
ccaagcaaagagtcagacaacactgtcaagacagccacacaggctcctggtcgggggtcc
cagggggactctgatggcaagcatgagactgtgaaccagcaagagaagagtggcccaggt
gcaggtggtagtggcagcggggacaccgacagcttctttaactccaaggtagcattgttc
gcagctgtaggtgctggctgcgtcatcttcctgctcattatcatctttttgacagtccta
ctactcaagctccgcaagcgacatcgcaagcatacacagcagcgggcggctgccctctcg
ctcagtaccctagccagccccaaagggggtagtggtacagcgggcactgagcccagcgac
atcatcatccccttacggactacagagaacaactactgcccccactatgagaaggtgagt
ggggactacgggcatcctgtctacatcgtccaggagatgccacctcagagcccggcgaac
atctactacaaggtctga

DBGET integrated database retrieval system