KEGG   Rattus norvegicus (rat): 25194Help
Entry
25194             CDS       T01003                                 

Gene name
Gnrh1, Gnrh, Gnrha, Lhrh, Rgnrhg1, SH-4
Definition
(RefSeq) gonadotropin releasing hormone 1
  KO
K05252  gonadotropin-releasing hormone
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25194 (Gnrh1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    25194 (Gnrh1)
   04912 GnRH signaling pathway
    25194 (Gnrh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GnRH
Motif
Other DBs
NCBI-GeneID: 25194
NCBI-ProteinID: NP_036899
RGD: 2720
Ensembl: ENSRNOG00000013441
UniProt: P07490
Position
15p12
AA seq 92 aa AA seqDB search
METIPKLMAAVVLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQN
FECTVHWPRSPLRDLRGALERLIEEEAGQKKM
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgatccccaaactgatggccgctgttgttctgttgactgtgtgtttggaaggc
tgctccagccagcactggtcctatgggttgcgccctggggggaagagaaatactgaacac
ttggttgattctttccaagagatgggcaaggaggaggatcaaatggcagaaccccagaac
ttcgaatgcactgtccactggccccgttcacctcttagggatctgcgaggagctctggaa
cgtctgattgaagaggaagctgggcagaagaagatgtaa

DBGET integrated database retrieval system