KEGG   Rattus norvegicus (rat): 25196
Entry
25196             CDS       T01003                                 

Gene name
Inhbb
Definition
(RefSeq) inhibin beta B subunit
  KO
K22687  inhibin beta B chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25196 (Inhbb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25196 (Inhbb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25196 (Inhbb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25196 (Inhbb)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   25196 (Inhbb)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide US22 TctA
Other DBs
NCBI-GeneID: 25196
NCBI-ProteinID: NP_542949
RGD: 2913
Ensembl: ENSRNOG00000060237
UniProt: P17491
Position
13q11
AA seq 411 aa
MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPSPAAPPPPPPPGAPGGSQDTCTSCGG
GGGGFRRPEELGRVDGDFLEAVKRHILSRLQLRGRPNITHAVPKAAMVTALRKLHAGKVR
EDGRVEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFVSNEGNQNLFVVQA
SLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNVVEKKVDLKRSGWHTFPITEAIQ
ALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLEC
DGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVN
QYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggacgggctgcccggtcgggcgttgggggccgcctgccttctgcttctggcggccggc
tggttgggacccgaggcctggggctctcccacacccccgccgtcgcccgctgcgccgccc
ccgcccccgccacccggagctccgggcggctcgcaggacacctgtacgtcgtgcggcggc
ggcggcggcggcttccggcggcccgaggagctgggccgggtggacggtgacttcctggag
gcggtgaagagacacatcttgagccgcctgcagttgcggggccggcccaacatcacgcac
gctgtccccaaggccgccatggtcacggccctgcgcaagctgcacgccggcaaggtgcgc
gaggacggccgcgtggagatcccgcacctcgacggccacgctagcccgggcgccgacggc
caggagcgcgtctctgagatcatcagctttgcagagacagatggcctcgcctcctcccgg
gtccgcctgtacttcttcgtctctaacgaaggcaaccagaacctatttgtggtgcaggcc
agcctgtggctgtacctgaaactgctcccctatgtcctggagaagggcagccggaggaag
gtacgggtcaaggtgtacttccaagaacagggtcacggtgacaggtggaatgtggtggag
aagaaggtggacctaaaacgtagtggctggcataccttccccattacagaggccatccag
gccttgtttgagcgaggcgagagacgccttaacctggatgttcagtgtgacagctgccag
gagctggccgtggtgcctgtgttcgtggaccccggtgaggagtcacaccggccctttgta
gtggtgcaggcccggctgggcgatagcagacatcgcatccgaaaacggggcctggagtgt
gacgggcggaccagcctctgttgcaggcaacagttcttcatcgactttcggctcatcggc
tggaacgactggatcattgcacccactggctactacgggaactactgtgagggcagctgc
ccggcctacctggctggggtccctggttcagcctcctccttccacacggctgtggtgaac
cagtaccgcatgcgtggcctgaaccctgggccggtgaactcttgctgcatccccaccaag
ctgagttctatgtctatgctctactttgatgacgagtacaacatcgtcaagcgggacgtg
cccaacatgatcgtggaggagtgtggctgcgcctga

DBGET integrated database retrieval system