KEGG   Rattus norvegicus (rat): 25196
Entry
25196             CDS       T01003                                 

Gene name
Inhbb
Definition
(RefSeq) inhibin beta B chain precursor
  KO
K22687  inhibin beta B chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25196 (Inhbb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25196 (Inhbb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25196 (Inhbb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25196 (Inhbb)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   25196 (Inhbb)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide US22 DUF411 TctA
Other DBs
NCBI-GeneID: 25196
NCBI-ProteinID: NP_542949
RGD: 2913
Ensembl: ENSRNOG00000060237
UniProt: P17491
Position
13
AA seq 411 aa
MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPSPAAPPPPPPPGAPGGSQDTCTSCGG
GGGGFRRPEELGRVDGDFLEAVKRHILSRLQLRGRPNITHAVPKAAMVTALRKLHAGKVR
EDGRVEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFVSNEGNQNLFVVQA
SLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNVVEKKVDLKRSGWHTFPITEAIQ
ALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLEC
DGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVN
QYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggacgggctgcccggtcgggcgttgggggccgcctgccttctgcttctggcggccggc
tggttgggacccgaggcctggggctctcccacacccccgccgtcgcccgctgcgccgccc
ccgcccccgccacccggagctccgggcggctcgcaggacacctgtacgtcgtgcggcggc
ggcggcggcggcttccggcggcccgaggagctgggccgggtggacggtgacttcctggag
gcggtgaagagacacatcttgagccgcctgcagttgcggggccggcccaacatcacgcac
gctgtccccaaggccgccatggtcacggccctgcgcaagctgcacgccggcaaggtgcgc
gaggacggccgcgtggagatcccgcacctcgacggccacgctagcccgggcgccgacggc
caggagcgcgtctctgagatcatcagctttgcagagacagatggcctcgcctcctcccgg
gtccgcctgtacttcttcgtctctaacgaaggcaaccagaacctatttgtggtgcaggcc
agcctgtggctgtacctgaaactgctcccctatgtcctggagaagggcagccggaggaag
gtacgggtcaaggtgtacttccaagaacagggtcacggtgacaggtggaatgtggtggag
aagaaggtggacctaaaacgtagtggctggcataccttccccattacagaggccatccag
gccttgtttgagcgaggcgagagacgccttaacctggatgttcagtgtgacagctgccag
gagctggccgtggtgcctgtgttcgtggaccccggtgaggagtcacaccggccctttgta
gtggtgcaggcccggctgggcgatagcagacatcgcatccgaaaacggggcctggagtgt
gacgggcggaccagcctctgttgcaggcaacagttcttcatcgactttcggctcatcggc
tggaacgactggatcattgcacccactggctactacgggaactactgtgagggcagctgc
ccggcctacctggctggggtccctggttcagcctcctccttccacacggctgtggtgaac
cagtaccgcatgcgtggcctgaaccctgggccggtgaactcttgctgcatccccaccaag
ctgagttctatgtctatgctctactttgatgacgagtacaacatcgtcaagcgggacgtg
cccaacatgatcgtggaggagtgtggctgcgcctga

KEGG   Rattus norvegicus (rat): 29200
Entry
29200             CDS       T01003                                 

Gene name
Inhba
Definition
(RefSeq) inhibin beta A chain preproprotein
  KO
K04667  inhibin beta A chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29200 (Inhba)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29200 (Inhba)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29200 (Inhba)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29200 (Inhba)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   29200 (Inhba)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 29200
NCBI-ProteinID: NP_058824
RGD: 62074
Ensembl: ENSRNOG00000014320
UniProt: P18331
Position
17
AA seq 424 aa
MPLLWLRGFLLASCWIIVRSSPTPGSEGHGAAPDCPSCALATLPKDGPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDMGDEAEEMGLKGERSELLLSEKVVDARKSTWHIFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEVDGDGKKKDGSDGGLEEEKEQSHRPFLMLQARQSED
HPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTS
GSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE
CGCS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcccttgctttggctgagaggatttctgttggcaagttgctggattatagtgaggagt
tcccccaccccaggatccgaggggcacggcgcagccccggactgcccgtcctgtgcgctg
gccacccttccgaaggatggacctaactctcagccagagatggtagaggctgtcaagaag
cacatcttaaacatgctgcacttgaagaagagacccgatgtcacccagccggtacccaag
gcggcgcttctcaacgcgatcagaaagcttcatgtgggtaaagtgggggaaaacgggtat
gtggagatagaggacgacattggcaggagggccgaaatgaatgaactcatggagcagacc
tcggagatcatcacctttgccgagtcaggcacagccaggaagacactgcattttgagatt
tccaaggaaggcagtgacctgtcagtcgtggagcgtgcagaagtctggctcttcctgaaa
gtccccaaggccaacaggaccaggaccaaagtcaccatccgtctgtttcagcagcagaag
catccacagggcagcttggacatgggggatgaggccgaggaaatgggcttgaagggggag
aggagtgaactgttgctatcagagaaagtggtagatgctcggaagagtacttggcacatc
ttcccagtgtctagcagcatccagcgcctgctggaccaggggaagagttccctggatgtg
cggattgcttgtgaacagtgccaggagagcggtgccagcctagtgctcctgggcaagaag
aagaagaaagaggtggatggagacgggaagaagaaagacggaagtgacggagggctggaa
gaggaaaaagaacagtcacacagacctttcctcatgctgcaggctaggcagtctgaagac
catcctcaccgcaggcgtaggcggggcttggagtgtgatggcaaggtcaacatttgctgt
aagaaacagttctttgtcagcttcaaggatattggctggaatgactggatcattgctccc
tctggctatcatgccaactattgtgagggtgagtgcccgagccacatagcaggcacctct
gggtcctcactctccttccactcaacagtcattaaccactaccgcatgaggggtcacagc
ccctttgccaaccttaagtcatgctgtgtgcccaccaagctgagacccatgtccatgctg
tattatgatgatggtcaaaacattatcaaaaaggacattcagaacatgattgtggaggag
tgtggctgctcctag

KEGG   Rattus norvegicus (rat): 64549
Entry
64549             CDS       T01003                                 

Gene name
Inhbc
Definition
(RefSeq) inhibin beta C chain precursor
  KO
K22688  inhibin beta C chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    64549 (Inhbc)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64549 (Inhbc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    64549 (Inhbc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    64549 (Inhbc)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   64549 (Inhbc)
SSDB
Motif
Pfam: TGF_beta RIF5_SNase_1
Other DBs
NCBI-GeneID: 64549
NCBI-ProteinID: NP_072136
RGD: 621194
Ensembl: ENSRNOG00000007700
UniProt: Q9WUK5
Position
7
AA seq 351 aa
MASSLLLALLFLTLATVVNLKTDGPCPACWGATFDLESHRELLLDLAKKSILDKLHLSQR
PILSRPVSREALKTALRRLRGTRAETLLEHDQRQEYEIISFADTGLSNINQTRLEFHFSD
RTTGGVEVLQTRFMFFMQLPPNTTQTMNIRVLVLRPYDTNLTLTSQYMLQVDASGWYQLL
LGPEAQAACSQGHLTLELVPESQLAHSSLILDGVSHRPFVAAQVRVEGKHRVRRRGINCQ
GLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNL
LKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcctcctccttgctcctggctcttctgttcctgactctagccacagtagtgaacctc
aaaactgatggtccatgtccagcatgttggggtgccacctttgacctggagagccatcgg
gagctccttctcgatttggccaagaaaagcatcctggacaagctgcacctcagccagcgc
cccatactcagtcggcctgtgtccagagaggccctcaagaccgcgctgcggcgcctccgt
gggactcgagcggaaaccctgttggagcatgaccagagacaagaatatgagatcatcagc
tttgctgacacaggcctctccaacatcaaccaaacccgtcttgaattccatttctctgat
agaactactggtggtgtggaggtcctgcagacccgtttcatgttcttcatgcagctccct
cccaacaccacccagaccatgaatataagagttcttgtgctaaggccatatgacaccaac
ctcaccttgacaagccagtacatgctgcaggtggatgccagtggctggtaccagcttctc
ctaggacccgaagctcaagctgcttgcagtcaggggcacctcactctggagctggtgcca
gaaagtcagctggcccacagttccttgatcctggatggggtttcccacaggccttttgtg
gcagcccaggtaagagttgaaggcaagcatcgggtacgccggcgaggtatcaactgccag
gggctgtccaggatgtgctgtcggcaagagttctttgtggacttccgtgagattggctgg
catgactggatcatccagcccgaaggctatgccatgaacttctgcactgggcagtgccca
ctacatgtggcaggcatgcctggcatctctgcgtcctttcacactgcagtgctgaatctg
ctcaaagccaacacagatgctggcactgcccgcaggggctcatgctgcgtgcctacgtct
cggcgccctctgtctttgctctactatgacagggacagcaacattgtcaagacggatata
cctgacatggtggtagaggcctgtgggtgcagttag

KEGG   Rattus norvegicus (rat): 83711
Entry
83711             CDS       T01003                                 

Gene name
Inhbe
Definition
(RefSeq) inhibin beta E chain precursor
  KO
K22689  inhibin beta E chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    83711 (Inhbe)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    83711 (Inhbe)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    83711 (Inhbe)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    83711 (Inhbe)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   83711 (Inhbe)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 83711
NCBI-ProteinID: NP_114003
RGD: 621196
Ensembl: ENSRNOG00000007601
UniProt: O88959 A0A0G2JSJ0
Position
7
AA seq 350 aa
MGLSNVQLWTILLWALAWVQSTRSACPSCGAPTLTPQGERALVLELAKQQILEGLHLTSR
PRITRPLPQAALTRALRRLQPRSMVPGNREKVISFATSIDKSTSTYRSVLTFQLSPLWSH
HLYHARLWLHVPPSFPATLYLRIFGCGTTRCRGSRTFLADYQTTSSGWHALTLPSSGLRS
EESGVTKLQLEFRPLDLNSTTARLPRLLLDTAGQQRPFLELKIRANEPGAGRARRRTPTC
ESETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgggactttcaaatgtccagctctggacaatactgctgtgggcattggcatgggtgcag
agtacaagatctgcgtgcccgtcctgtggggccccaactctgacaccccaaggagaacgc
gctctggtcctagagctagccaagcagcaaatcctggaggggctgcacctaaccagccgt
cccagaataactcgtcctctgccccaggcagcactgaccagagccctccggagactgcag
cccaggagcatggtccctggcaaccgagagaaagtcatcagctttgctaccagcatagac
aaatccacttcaacctaccgctccgtgctcaccttccaactgtcccctctttggtcccac
cacctgtaccatgcccgcctctggctgcacgtgcccccctcttttccggccactctgtat
ctgaggatcttcggttgcggtaccacgaggtgcagaggatcccgcacgttcctagctgat
taccaaaccacttcctccggctggcacgccctgactctgccctctagcggcttgcggagt
gaggaatctggagtcacaaaactccaactggaattcagacctctggaccttaacagcact
actgccagactgccacggctgctgttggacacagcgggacagcagcgtcccttcttggaa
cttaagatccgagctaatgaacccggagcaggccgggccaggaggaggactcccacctgt
gagtctgagacccccttatgttgtagacgagaccactatgtcgatttccaggagctgggg
tggagagactggatcctgcagccggagggataccagctgaattactgcagtgggcagtgc
ccgccccacctggctggcagccctggcattgctgcttccttccattctgctgtctttagc
ctcctcaaagccaacaacccttggcctgcgggttcttcctgctgtgtccccaccgcgcga
aggcctctctccctcctctaccttgaccataatggcaatgtggtcaagaccgatgtgcca
gacatggttgtagaggcctgtggctgcagctag

DBGET integrated database retrieval system