KEGG   Rattus norvegicus (rat): 25202Help
Entry
25202             CDS       T01003                                 

Gene name
Gucy1b3, Gucy1b1, SGC
Definition
(RefSeq) guanylate cyclase 1 soluble subunit beta 3
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    25202 (Gucy1b3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    25202 (Gucy1b3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25202 (Gucy1b3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25202 (Gucy1b3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25202 (Gucy1b3)
   04924 Renin secretion
    25202 (Gucy1b3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25202 (Gucy1b3)
  09154 Digestive system
   04970 Salivary secretion
    25202 (Gucy1b3)
  09156 Nervous system
   04730 Long-term depression
    25202 (Gucy1b3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25202 (Gucy1b3)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     25202 (Gucy1b3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 25202
NCBI-ProteinID: NP_036901
RGD: 2769
Ensembl: ENSRNOG00000012060
UniProt: P20595
Structure
PDB: 

Position
2q34
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRSEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQDSRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGKCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETNQDEN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggttttgtgaaccatgccctggagctgctggtgatccgcaattacggtcccgag
gtgtgggaagacatcaaaaaagaggcgcagctggatgaagaaggccagtttcttgtgaga
ataatctacgatgattccaaaacctatgacttggtggctgctgcgagcaaagtcctcaac
ctcaatgctggtgaaatcctgcagatgtttgggaagatgtttttcgtcttctgtcaagag
tctggctatgataccatcttgcgtgtcctgggatctaatgtcagggagtttttgcagaac
ctcgacgccctgcacgaccacctcgccaccatctacccagggatgcgcgcaccttccttc
cggtgcaccgatgcagaaaaaggcaaagggctcattctgcactactactcggaaagagag
gggcttcaggacattgtgatcgggattatcaagactgtagctcaacagatccatggcact
gagatagacatgaaggttattcagcaaagaagtgaagaatgtgatcatacccaattttta
attgaagaaaaagaatcaaaagaagaggatttttatgaagatctggacaggtttgaagag
aacggtacccaggactcccgtatcagcccgtacaccttctgcaaagcgtttccttttcac
atcatatttgaccgggacctagtagtcacgcagtgtggaaatgctatctacagagtgctc
ccccagctccagcctgggaagtgcagccttctgtctgtcttctctctggtccgccctcat
attgacatcagtttccacgggattctttcacacatcaataccgtctttgtactgagaagc
aaggaagggttgctggatgttgagaaacttgaatgtgaggatgaactgactggggcagag
attagctgcctccgtctcaaaggccaaatgatctatttaccggaagcagatagcatcctc
ttcctctgttcaccaagtgtgatgaacttggatgacctaacaagaagaggcctgtacctg
agtgacatccctctccatgatgctacacgagacctggtccttttgggagaacagttccgg
gaggagtacaaactgacacaagagctggaaatcctcacagacaggctgcagctcacactg
agggctttggaggatgagaagaaaaagacagacacattgctatattctgttctccctcca
tctgttgccaatgagctgagacacaagcgtccagtgccggccaaaagatacgacaatgtg
accatcctcttcagtggcattgtgggcttcaacgctttctgtagcaagcatgcatctgga
gaaggggccatgaagattgtcaatctactcaacgacctctacaccagattcgacacactg
actgattcacggaaaaacccatttgtttacaaggtggaaacagttggtgacaagtatatg
acagtgagtggtttgccagaaccttgtatccaccatgcacggtccatttgccacctggct
ttagacatgatggaaattgctggtcaagttcaagtagatggcgaatctgttcagataacc
atcgggatccacactggggaggtggtgacaggtgtgattggacagcggatgccacggtat
tgtctcttcggaaatactgtcaacctcacaagcaggacagaaaccacaggagaaaagggg
aagataaacgtttccgaatatacatacaggtgtctcatgtccccagaaaactcggatcca
cagttccacttggagcacagaggtcctgtgtccatgaagggcaagaaggagccaatgcaa
gtctggtttctatccaggaaaaacacaggcacagaggaaacaaaccaggatgaaaactga

DBGET integrated database retrieval system