KEGG   Rattus norvegicus (rat): 25202
Entry
25202             CDS       T01003                                 

Gene name
Gucy1b1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    25202 (Gucy1b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    25202 (Gucy1b1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25202 (Gucy1b1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25202 (Gucy1b1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25202 (Gucy1b1)
   04924 Renin secretion
    25202 (Gucy1b1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25202 (Gucy1b1)
  09154 Digestive system
   04970 Salivary secretion
    25202 (Gucy1b1)
  09156 Nervous system
   04730 Long-term depression
    25202 (Gucy1b1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25202 (Gucy1b1)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     25202 (Gucy1b1)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 25202
NCBI-ProteinID: NP_036901
RGD: 2769
Ensembl: ENSRNOG00000012060
UniProt: P20595
Structure
PDB: 
3HLS

Position
2
AA seq 619 aa
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRSEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQDSRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGKCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETNQDEN
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtacggttttgtgaaccatgccctggagctgctggtgatccgcaattacggtcccgag
gtgtgggaagacatcaaaaaagaggcgcagctggatgaagaaggccagtttcttgtgaga
ataatctacgatgattccaaaacctatgacttggtggctgctgcgagcaaagtcctcaac
ctcaatgctggtgaaatcctgcagatgtttgggaagatgtttttcgtcttctgtcaagag
tctggctatgataccatcttgcgtgtcctgggatctaatgtcagggagtttttgcagaac
ctcgacgccctgcacgaccacctcgccaccatctacccagggatgcgcgcaccttccttc
cggtgcaccgatgcagaaaaaggcaaagggctcattctgcactactactcggaaagagag
gggcttcaggacattgtgatcgggattatcaagactgtagctcaacagatccatggcact
gagatagacatgaaggttattcagcaaagaagtgaagaatgtgatcatacccaattttta
attgaagaaaaagaatcaaaagaagaggatttttatgaagatctggacaggtttgaagag
aacggtacccaggactcccgtatcagcccgtacaccttctgcaaagcgtttccttttcac
atcatatttgaccgggacctagtagtcacgcagtgtggaaatgctatctacagagtgctc
ccccagctccagcctgggaagtgcagccttctgtctgtcttctctctggtccgccctcat
attgacatcagtttccacgggattctttcacacatcaataccgtctttgtactgagaagc
aaggaagggttgctggatgttgagaaacttgaatgtgaggatgaactgactggggcagag
attagctgcctccgtctcaaaggccaaatgatctatttaccggaagcagatagcatcctc
ttcctctgttcaccaagtgtgatgaacttggatgacctaacaagaagaggcctgtacctg
agtgacatccctctccatgatgctacacgagacctggtccttttgggagaacagttccgg
gaggagtacaaactgacacaagagctggaaatcctcacagacaggctgcagctcacactg
agggctttggaggatgagaagaaaaagacagacacattgctatattctgttctccctcca
tctgttgccaatgagctgagacacaagcgtccagtgccggccaaaagatacgacaatgtg
accatcctcttcagtggcattgtgggcttcaacgctttctgtagcaagcatgcatctgga
gaaggggccatgaagattgtcaatctactcaacgacctctacaccagattcgacacactg
actgattcacggaaaaacccatttgtttacaaggtggaaacagttggtgacaagtatatg
acagtgagtggtttgccagaaccttgtatccaccatgcacggtccatttgccacctggct
ttagacatgatggaaattgctggtcaagttcaagtagatggcgaatctgttcagataacc
atcgggatccacactggggaggtggtgacaggtgtgattggacagcggatgccacggtat
tgtctcttcggaaatactgtcaacctcacaagcaggacagaaaccacaggagaaaagggg
aagataaacgtttccgaatatacatacaggtgtctcatgtccccagaaaactcggatcca
cagttccacttggagcacagaggtcctgtgtccatgaagggcaagaaggagccaatgcaa
gtctggtttctatccaggaaaaacacaggcacagaggaaacaaaccaggatgaaaactga

KEGG   Rattus norvegicus (rat): 25206
Entry
25206             CDS       T01003                                 

Gene name
Gucy1b2
Definition
(RefSeq) guanylate cyclase soluble subunit beta-2 isoform 2
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    25206 (Gucy1b2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    25206 (Gucy1b2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25206 (Gucy1b2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25206 (Gucy1b2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    25206 (Gucy1b2)
   04924 Renin secretion
    25206 (Gucy1b2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25206 (Gucy1b2)
  09154 Digestive system
   04970 Salivary secretion
    25206 (Gucy1b2)
  09156 Nervous system
   04730 Long-term depression
    25206 (Gucy1b2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25206 (Gucy1b2)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     25206 (Gucy1b2)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 25206
NCBI-ProteinID: NP_036902
RGD: 2770
Ensembl: ENSRNOG00000009440
UniProt: P22717 Q80WX7 A0A0G2K4T2
Position
15
AA seq 707 aa
MTYTVYDDIITIKLIQEACKVLDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEF
IENLDALHSYLALSYQEMNAPSFRVEEGADGAMLLHYYSDRHGLCHIVPGIIEAVAKDFF
DTDVAMSILDMNEEVERTGKKEHVVFLVVQKAHRQIRGAKASRPQGSEDSQADQEALQGT
LLRMKERYLNIPVCPGEKSHSTAVRASVLFGKGPLRDTFQPVYPERLWVEEEVFCDAFPF
HIVFDEALRVKQAGVNIQKYVPGILTQKFALDEYFSIIHPQVTFNISSICKFINSQFVLK
TRKEMMPKARKSQPMLKLRGQMIWMESLRCMIFMCSPKLRSLQELEESKMHLSDIAPHDT
TRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKE
GRKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTSVHDVYKVETI
GDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVTGEPIQIRVGIHTGPVLAGVV
GDKMPRYCLFGDTVNTASRMESHGLPSKVHLSPTAHRALKNKGFEIVRRGEIEVKGKGKM
TTYFLIQNLNATEDEIMGRPSAPADGKEVCTPGNQVRKSPAVPRNTDHQQQVYKGDPADA
SNEVTLAGSPVAGRNSTDAVNNQPSPDETKTSVVASGPVLSAFCVVL
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgacctacaccgtgtatgatgacatcatcaccattaagctcatccaagaagcctgcaag
gttctggatgtgtccatggaagccattctgaagctctttggcgaatacttctttaagttc
tgtaagatgtctggctatgacaggatgctgcggacacttggaggaaatctcaccgagttt
attgaaaacctagatgcactccacagttacctggcactgtcctatcaggaaatgaacgca
ccatcctttcgagtggaggaaggagctgacggggcgatgcttctccactactactcagac
agacatggtctgtgtcacattgtaccaggtatcattgaagctgtggccaaggacttcttt
gacactgatgtggccatgagtatcctggatatgaacgaagaggtggaaaggacagggaag
aaagaacatgttgtgtttctggtcgtgcagaaggctcacagacagataagaggagcaaag
gcaagccggccacaaggcagtgaggacagccaggcagaccaggaggctctccagggaaca
ctccttcggatgaaggagagatatttaaacatccctgtttgccctggggagaaatctcac
tcaactgctgtgagggcatcggtcctttttggaaaagggcccctcagggacaccttccag
cccgtctatcctgagagactatgggtcgaagaggaggtgttctgtgatgcttttcctttc
cacattgtctttgatgaagcactaagggtcaagcaagctggagtgaatattcagaagtat
gtccctggaatcttaacccagaagtttgcactagatgagtatttttccatcatccaccct
caagttactttcaacatctccagcatctgcaagttcattaacagtcagtttgtcttgaag
acaagaaaagaaatgatgcccaaagcaaggaagagccagccgatgctcaaactccggggt
cagatgatctggatggagtctctgaggtgcatgatcttcatgtgttccccaaagctccgc
agcctgcaagagctggaagagagcaagatgcatctttctgatatcgctccgcacgacacg
accagggatctcatcctcctcaaccagcagaggctggcagagatggagctgtcctgccaa
ctggaaaagaagaaggaggagttgcgtgtcctttccaatcacctggccatcgagaagaag
aagacagagaccttgctgtatgccatgctgcctgaacatgtggccaaccaactcaaggag
ggcagaaaggtggctgcaggagaatttgaaacatgtacaatccttttcagcgatgttgtg
acatttaccaacatctgtgcagcctgtgaacctatccaaatcgtgaacatgctgaattca
atgtactccaagtttgacaggttaaccagtgtccatgatgtctacaaagtagaaacaata
ggggatgcttacatggtggtgggtggagtaccagtacccgttgaaagccatgctcaaaga
gtcgccaattttgctctggggatgagaatttctgcaaaagaagtgatgaatcctgtcact
ggggaacctatccagatcagagtgggaatccacactggaccagtcttagcaggtgttgtg
ggagacaagatgcctcggtactgcttgtttggtgacactgtaaacacagcctctaggatg
gaaagtcacgggcttcccagcaaagtgcatctgagccccacagcccacagagccctgaaa
aacaaagggtttgaaattgtcaggagaggcgagatcgaagtgaaggggaaaggaaagatg
accacatactttctgatccagaacctgaatgccaccgaggatgagataatggggcgacct
tcagcccccgctgatgggaaggaagtatgtactcccggaaaccaagtcaggaagtcccct
gctgtcccgaggaacacagaccatcagcaacaagtctacaaaggagacccagcagacgct
tctaatgaagtcacacttgctgggagcccagtggcagggcgaaactccacagatgcagtc
aataaccagccatcaccagatgagaccaagacaagtgtcgttgctagtggccctgtgctg
tctgctttctgtgttgtgctgtga

KEGG   Rattus norvegicus (rat): 497757
Entry
497757            CDS       T01003                                 

Gene name
Gucy1a1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-1
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    497757 (Gucy1a1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    497757 (Gucy1a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    497757 (Gucy1a1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    497757 (Gucy1a1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    497757 (Gucy1a1)
   04924 Renin secretion
    497757 (Gucy1a1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    497757 (Gucy1a1)
  09154 Digestive system
   04970 Salivary secretion
    497757 (Gucy1a1)
  09156 Nervous system
   04730 Long-term depression
    497757 (Gucy1a1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    497757 (Gucy1a1)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     497757 (Gucy1a1)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 497757
NCBI-ProteinID: NP_058786
RGD: 68436
Ensembl: ENSRNOG00000012302
UniProt: Q5U330
Position
2
AA seq 690 aa
MFCRKFKDLKITGECPFSLLAPGQVPTEPIEEVAGVSESCQATLPTCQEFAENAEGSHPQ
RKTSRNRVYLHTLAESIGKLIFPEFERLNLALQRTLAKHKIKENRNSSEKEDLERIIAEE
AIAAGVPVEALKDSLGEELFKICYEEDEHILGVVGGTLKDFLNSFSTLLKQSSHCQEAER
RGRLEDASILCLDKDQDFLNVYYFFPKRTTALLLPGIIKAAARILYESHVEVSLMPPCFR
SECTEFVNQPYLLYSVHVKSTKPSLSPGKPQSSLVIPTSLFCKTFPFHFMLDRDLAILQL
GNGIRRLVNKRDFQGKPNFEEFFEILTPKINQTFSGIMTMLNMQFVIRVRRWDNLVKKSS
RVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARA
QDGLKKRLGKLKATLEHAHQALEEEKKKTVDLLCSIFPSEVAQQLWQGQIVQAKKFNEVT
MLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHRE
SDTHAVQIALMALKMMELSNEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNV
TLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSDIPGICHFLDAYQ
HQGPNSKPWFQQKDAEDGNANFLGKASGVD
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgttctgcaggaagttcaaagatctcaagatcacgggggagtgtcctttctccttactg
gctcctggtcaggttcctacggagccaatagaggaggtggccggagtctctgagagctgc
caggccactctgcccacctgccaggagtttgctgagaatgcagaagggagtcacccccaa
agaaagacaagccgcaacagagtctacctacacaccctggcagagagtattggcaagctc
attttcccagagtttgagagactgaaccttgcacttcagagaacattggcaaagcacaaa
ataaaggaaaacaggaattcttcagaaaaagaagaccttgaaagaataattgcagaagaa
gcaattgcggcaggtgtcccagtggaggcgctcaaagactctctgggtgaggaactgttc
aagatctgttatgaggaagatgagcacatcctgggcgtggttggcggcaccctgaaggac
tttctcaacagcttcagcacgctcctgaagcagagcagccactgccaggaggcggagagg
cgggggcgactggaagatgcctccatcttgtgcctggacaaggaccaggactttctaaat
gtttactacttcttcccgaagagaaccacagccctgcttctccccggtatcattaaagcg
gctgctcgcatactgtacgaaagccacgtggaggtgtccctgatgcctccctgcttccga
agtgagtgtaccgaattcgtgaaccagccctatttgctctactcggtccacgtgaagagc
accaagccttctctgtccccaggcaaaccccagtcctcgctagtgatccctacttcgctc
ttctgcaaaactttcccattccacttcatgctggaccgtgacctggccattctgcagctg
ggtaatggcatcagaaggctggtgaacaagagggacttccaagggaagcccaactttgaa
gagttctttgaaattctaactcccaaaatcaaccagacatttagcggcatcatgacaatg
ttgaatatgcagtttgtcatacgggtgaggagatgggataacttagtgaagaaatcttca
agggttatggacctcaaaggtcaaatgatctacatcgttgaatccagtgccatcttgttc
ttagggtcgccgtgtgtggacagattggaagatttcacaggacggggtctctatctgtct
gacatcccgattcataatgccctgagggatgttgtcttgataggggaacaggcacgggct
caagatggcctcaagaagaggttgggaaagctgaaggcaaccttggagcatgcccaccaa
gccctggaggaggagaagaagaagacggtagatctcctgtgttctatctttccctctgag
gttgctcagcagctctggcaaggacaaattgtgcaagccaagaagttcaatgaggtcacc
atgctcttctcagatatcgtagggttcactgccatctgctctcagtgttcacctctgcag
gtcatcaccatgctcaacgctctctatactcgctttgaccaacagtgtggagagctggat
gtctacaaggtggagaccatcggagatgcatattgtgtggcagggggattgcacagagag
agtgacacacatgctgtccagatagcactgatggccctgaagatgatggagctctccaat
gaggtcatgtctccccacggagaacctatcaagatgcgaatcggactgcattctgggtca
gtgtttgctggagttgttggagtgaagatgccccgatattgcctgtttggaaacaatgtc
actctggctaacaaatttgagtcctgcagtgtgcctcggaaaatcaatgtcagccccacg
acatacaggttactcaaagactgtcctggctttgtgttcaccccgagatcgagggaggag
cttccaccaaacttccctagtgacattcctggaatctgtcactttctggatgcttatcaa
catcaaggacctaattctaaaccatggttccagcagaaagatgcagaagatggaaacgct
aacttcttaggcaaagcatcaggggtagattag

KEGG   Rattus norvegicus (rat): 66012
Entry
66012             CDS       T01003                                 

Gene name
Gucy1a2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    66012 (Gucy1a2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    66012 (Gucy1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    66012 (Gucy1a2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    66012 (Gucy1a2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    66012 (Gucy1a2)
   04924 Renin secretion
    66012 (Gucy1a2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    66012 (Gucy1a2)
  09154 Digestive system
   04970 Salivary secretion
    66012 (Gucy1a2)
  09156 Nervous system
   04730 Long-term depression
    66012 (Gucy1a2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    66012 (Gucy1a2)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     66012 (Gucy1a2)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB RskA
Other DBs
NCBI-GeneID: 66012
NCBI-ProteinID: NP_076446
RGD: 621655
Ensembl: ENSRNOG00000029876
Vega: OTTRNOG00000002250
UniProt: Q9WVI4
Position
8
AA seq 730 aa
MSRRKISSESFSSLGSDYLETSPEEEGECPLSKLCWNGSRSPPGPPGSRAAAMAATPVPA
ASVAAAAAAVAAGSKRAQRRRRVNLDSLGESISLLTAPSPQTIHMTLKRTLQYYEHQVIG
YRDAEKNFHNISNRCSSADHSNKEEIEDVSGILRCTANVLGLKFQEIQERFGEEFFKICF
DENERVLRAVGSTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLKLHYFHP
HHTVGFAMLGMIKAAGKRIYHLNVEVEQIENEKFCSDGSTPSNYSCLTFLIKECETTQIT
KNIPQGTSQIPTDLRISINTFCRTFPFHLMFDPNMVVLQLGEGLRKQLRCDNHKVLKFED
CFEIVSPKVNATFDRVLLRLSTPFVIRTKPEASGTDNEDKVMEIKGQMIHVPESNAILFL
GSPCVDKLDELIGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLEKTHQA
LEEEKKKTVDLLYSIFPGDVAQQLWQRQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQV
ISMLNELYTRFDHQCGFLDIYKVETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEE
VLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINISPTT
YQLLKREDSFTFIPRSREELPDNFPKEIPGVCYFLELRTGPKPPKPSLSSSRIKKVSYNI
GTMFLRETSL
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtctcgcaggaagatttcatccgagtccttcagctctctgggctccgattacctggag
accagcccggaagaggaaggggaatgccccttgtctaagctctgctggaatggcagccgg
agcccgccagggccacctggctccagagcagccgctatggctgccaccccagtccccgct
gcctctgtcgctgcggcagctgctgcagtcgccgccgggtccaagagagcccaacgccgc
cggagggtcaacctggactcactgggcgagagtatcagtctcctgacggcgccctcgcct
cagacgatacacatgactctcaagaggacattgcagtattatgaacatcaagttattggt
tatagggatgcagaaaagaatttccacaatatctctaatagatgctcctctgcagaccat
tccaacaaagaggaaattgaagatgtctcaggaattcttcggtgtactgcaaatgtactc
ggactgaagttccaagaaattcaagagaggtttggtgaggaattctttaagatatgcttt
gatgagaatgagcgagtccttcgagctgtaggcagcacattgcaggatttcttcaatggc
ttcgatgcattgttggaacacattaggacttcatttgggaaacaggccactctagagtca
ccatctttcctatgcaaagagcttcctgaaggtactctcaaactccactacttccacccc
caccatacagtgggcttcgcaatgctgggaatgatcaaggctgcaggaaagagaatctat
cacttaaatgtggaagttgaacaaattgaaaatgagaaattttgctctgatggttcaacc
ccaagcaattatagctgtcttaccttccttatcaaagaatgtgagactactcagatcaca
aagaacattccacaaggtacttcccaaattcctacagacctcagaatcagtatcaacacc
ttctgcagaaccttcccattccatttgatgttcgaccctaacatggtggtccttcaactt
ggagagggcctacgaaagcaacttcgatgtgacaatcacaaagtactgaagtttgaggac
tgttttgagatcgtctctccaaaggttaatgccacttttgatagagtcttgctacgattg
tccaccccatttgtgataaggacaaagcctgaagcttctggtactgacaatgaagataag
gtgatggaaatcaaaggacaaatgatccatgtcccagaatcaaatgccattttgtttttg
ggctctccatgtgtggacaagttggatgaactcataggccgaggactgcatctctcagac
atccccattcatgatgccactcgagatgtcattttagttggagagcaagcaaaggcccag
gatggcttgaaaaagaggatggataaattaaaagccaccttagaaaaaactcaccaggcc
ctggaagaagagaaaaagaagacagtggatctgctgtattccattttccctggtgatgta
gcccagcagttgtggcaacgacagcaagtacaggccagaaagtttgatgatgtcactatg
ctcttctctgacattgtgggcttcacagctatatgtgcccagtgtactcccatgcaggtg
atcagcatgctcaatgaactttacacgagatttgatcaccagtgtggctttttggatatt
tacaaggtagaaacaataggggacgcatactgtgttgcatcagggcttcacaggaaaagc
ctatgccatgcgaagcccattgctctgatggccttaaagatgatggagctttcagaagag
gttctgactcctgatggaagacccattcagatgcggataggcattcattcaggctctgtg
ctagctggtgtggtcggagtgagaatgccgcgatattgtctttttggaaataatgtcact
ctggcaagcaaatttgaatctggaagtcatcctcggcgcatcaacatcagcccaactact
taccaattactaaaacgagaagacagtttcacatttattcctcgttctcgtgaagaactt
ccagacaactttccaaaggaaatccctggggtctgctatttcctggagttaaggactggc
ccaaagccaccaaagccatccctgtcttcatcgagaataaaaaaggtttcctacaatatt
ggcacgatgttcctccgagaaactagcctctga

DBGET integrated database retrieval system