KEGG   Rattus norvegicus (rat): 25203Help
Entry
25203             CDS       T01003                                 

Gene name
Ccnb1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    25203 (Ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25203 (Ccnb1)
   04114 Oocyte meiosis
    25203 (Ccnb1)
   04115 p53 signaling pathway
    25203 (Ccnb1)
   04218 Cellular senescence
    25203 (Ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25203 (Ccnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25203 (Ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    25203 (Ccnb1)
   03036 Chromosome and associated proteins [BR:rno03036]
    25203 (Ccnb1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    25203 (Ccnb1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    25203 (Ccnb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 25203
NCBI-ProteinID: NP_741988
RGD: 2291
Ensembl: ENSRNOG00000058539
UniProt: P30277
Position
2q12
AA seq 423 aa AA seqDB search
MALRVTRNTKINTENKAKVSMAGAKRVPVAVAASKPLLRSRTALGDIGNKVSEQSRIPLK
KETKKLGSGTVTVKALPKPVDKVPVCEPEVELDEPEPEPVMEVKHSPEPILVDTPSPSPM
ETSGCAPAEEYLCQAFSDVILAVSDVDADDGGDPNLCSEYVKDIYAYLRQLEEEQSVRPK
YLLGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQDSCVPKKMLQLVGVT
AMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRAS
KIGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKILDNGEWTPTLQHYLS
HTEESLLPVMQHLAKNIVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNCTLVQNLSKAV
TKA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcagggtcactaggaacacgaaaattaacacagaaaataaggccaaggtcagc
atggcaggcgccaagcgtgtgcctgtggcagttgctgcctccaaacccctgctgagatcg
agaactgctcttggagacattggtaataaagtcagcgaacagtcaagaatacccctcaaa
aaggaaacaaaaaagttaggttctggaacagttactgttaaagccctaccaaaacctgtg
gacaaggtgccagtgtgcgaaccagaggtggaactggatgagcctgagcctgaacctgtt
atggaagtgaaacactctcctgagcctattttggttgatactccctctccaagcccaatg
gaaacatctggatgtgcacctgccgaagaatatctgtgtcaggctttctccgatgtgatt
cttgcagtgagtgatgtagatgcagacgatggtggtgatccaaacctctgtagtgaatat
gtgaaagatatctatgcttacctcagacaactggaggaagagcagtcagttagaccaaaa
tacctactgggtcgtgaagtcactggaaacatgagagccatcctaatcgactggctaata
caggttcagatgaaatttcggctgctgcaggagaccatgtacatgactgtgtccattatc
gatcggttcatgcaggacagttgtgtgcccaagaagatgctgcagctggttggtgtaact
gccatgtttattgcaagcaaatacgaggagatgtaccctccagagatcggtgacttcgct
tttgtgactaacaacacttacaccaagcaccagatcagacagatggagatgaagattctg
agagttctgaacttcagtctgggtcgccctctgcctctgcacttcctccgtagagcatct
aaaattggagaggtcgatgtggagcagcatactttggccaaatacctcatggagctctcc
atgctggactacgacatggtgcattttgccccttctcaaattgcagctggggctttttgc
ttagccctgaaaatccttgacaacggtgaatggacaccaactctgcagcactacctgtcc
cacacggaggaatctctgcttcctgtgatgcagcacctggctaagaacatagtcatggtg
aaccgtggcctcacaaagcacatgacgatcaagaacaagtatgcaacatctaagcatgct
aagatcagcactctggcacagctgaattgtacactagttcagaatttgtctaaggccgtg
acaaaggcgtaa

DBGET integrated database retrieval system